現(xiàn)貨供應,歡迎訂購: : Trefoil Factor-1 Human Recombinant 5ug/20ug/1mg Catalogue Number | CYT-586 | Synonyms | TFF-1, TFF1, pS2, BCEI, HPS, HP1.A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein. | Introduction | The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are stable secretory proteins expressed in the gastrointestinal tract (gastric mucosa), and are involved in intestinal mucosal defense and repair. TFF1 is an essential protein for normal differentiation of the antral and pyloric gastric mucosa and functions as a gastric-specific tumor suppressor gene. TFF1 is a stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. TFF1 protects the mucosa from isults, stabilizes the mucus layer, & affects healing of the epithelium. TFF1 is commonly expressed in tumors. TFF1 is related with the cell membrane of MCF-7 cells. High levels of TFF1 and TFF2 are found in serum from inflammatory bowel disease. | Description | TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved interamolecular disulfide bonds and having a total molecular mass of 13.2 kDa. TFF-1 Human Recombinant is purified by proprietary chromatographic techniques. | Source | Escherichia Coli. | Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | Formulation | The protein was lyophilized after dialysis against 1xPBS pH-7.4. | Solubility | It is recommended to reconstitute the lyophilized TFF1 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. | Stability | Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | Purity | Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | Amino acid sequence | EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY PNTIDVPPEEECEF. | Biological Activity | Determined by its ability to activate ERK1/2 (a MAPkinase signaling molecule) using a concentration 1,000-2,000ng/ml corresponding to a specific activity of 500-1,000IU/mg. | Usage | ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. | Related Products | |
Related Products Activin A cyt-569 Hystemcell.cn Recombinant Human Activin-A Activin A Plant-Active cyt-414 Hystemcell.cn Recombinant Human Activin-A Active Activin A HEK-Active cyt-078 Hystemcell.cn Recombinant Human Activin-A HEK-Active Activin A Plant cyt-052 Hystemcell.cn Recombinant Human Activin-A, Plant Activin B Active cyt-057 Hystemcell.cn Recombinant Human Activin-B Active Activin B cyt-058 Hystemcell.cn Recombinant Human Activin-B Activin A, Active cyt-145 Hystemcell.cn Recombinant Human Activin-A, Active mActivin A cyt-146 Hystemcell.cn Recombinant Mouse Activin-A rActivin A cyt-147 Hystemcell.cn Recombinant Rat Activin-A Acrp30 cyt-024 Human Adiponectin Acrp30 cyt-280 Hystemcell.cn Recombinant Human Adiponectin Acrp30 His cyt-433 Hystemcell.cn Recombinant Human Adiponectin, His tag mAcrp30 His cyt-537 Hystemcell.cn Recombinant Mouse Adiponectin, His tag Acrp30 HEK cyt-434 Hystemcell.cn Recombinant Human Adiponectin glycosilated, HEK mAcrp30 HEK cyt-435 Hystemcell.cn Recombinant Mouse Adiponectin glycosilated, HEK pAcrp30 HEK cyt-696 Hystemcell.cn Recombinant Porcine Adiponectin glycosilated, HEK Acrp30 Tri cyt-233 Hystemcell.cn Recombinant Human Adiponectin Trimeric Form mAcrp30 Tri cyt-247 Hystemcell.cn Recombinant Mouse Adiponectin Trimeric Form gAcrp30 cyt-615 Hystemcell.cn Recombinant Human Adiponectin Globular gAcrp30 His cyt-277 Hystemcell.cn Recombinant Human Adiponectin Globular, His tag mgAcrp30 cyt-432 Hystemcell.cn Recombinant Mouse Adiponectin Globular AIF1 cyt-697 Hystemcell.cn Recombinant Human Allograft Inflammatory Factor 1 AIF1L cyt-007 Hystemcell.cn Recombinant Human Allograft Inflammatory Factor 1 Like AITRL cyt-076 Hystemcell.cn Recombinant Human AITRL AITRL His cyt-317 Hystemcell.cn Recombinant Human AITRL, His Tag ANGPT1 cyt-074 Hystemcell.cn Recombinant Human Angiopoietin-1 ANGPTL3 cyt-248 Hystemcell.cn Recombinant Human Angiopoietin-like Protein 3 ANGPTL4 cyt-249 Hystemcell.cn Recombinant Human Angiopoietin-like Protein 4 ANGPTL4 HEK cyt-698 Hystemcell.cn Recombinant Human Angiopoietin-like Protein 4, HEK APOA1 cyt-661 Hystemcell.cn Recombinant Human Apolipoprotein A-I APOA1 cyt-037 Human Apolipoprotein A-I APOA2 cyt-038 Human Apolipoprotein A-II APOA5 cyt-025 Hystemcell.cn Recombinant Human Apolipoprotein A-V AREG cyt-041 Hystemcell.cn Recombinant Human Amphiregulin Clusterin cyt-278 Hystemcell.cn Recombinant Human Apoliprotein-J Clusterin cyt-548 Human Apoliprotein-J rClusterin cyt-437 Hystemcell.cn Recombinant Rat Apoliprotein-J k9Clusterin cyt-549 Hystemcell.cn Recombinant Canine Apoliprotein-J k9Clusterin HEK cyt-618 Hystemcell.cn Recombinant Canine Apoliprotein-J HEK APO D cyt-547 Hystemcell.cn Recombinant Human Apoliprotein-D APO D GST cyt-652 Hystemcell.cn Recombinant Human APO-D GST Tag APOH cyt-189 Hystemcell.cn Recombinant Human Apoliprotein-H APOM cyt-715 Hystemcell.cn Recombinant Human Apolipoprotein-M APOM HEK cyt-026 Hystemcell.cn Recombinant Human Apolipoprotein-M, HEK Artemin cyt-306 Hystemcell.cn Recombinant Human Artemin BD 1 cyt-564 Hystemcell.cn Recombinant Human Beta Defensin -1 mBD 1 cyt-044 Hystemcell.cn Recombinant Mouse Beta Defensin -1 rBD 1 cyt-062 Hystemcell.cn Recombinant Rat Beta Defensin -1 BD 2 cyt-571 Hystemcell.cn Recombinant Human Beta Defensin -2 mBD 2 cyt-035 Hystemcell.cn Recombinant Mouse Beta Defensin -2 BD 3 cyt-461 Hystemcell.cn Recombinant Human Beta Defensin -3 mBD 3 cyt-036 Hystemcell.cn Recombinant Mouse Beta Defensin -3 rBD 3 cyt-063 Hystemcell.cn Recombinant Rat Beta Defensin -3 BD 4 cyt-599 Hystemcell.cn Recombinant Human Beta Defensin -4 rBD 4 cyt-066 Hystemcell.cn Recombinant Rat Beta Defensin -4 BDNF cyt-207 Hystemcell.cn Recombinant Human Brain-Derived Neurotrophic Factor proBDNF cyt-014 Hystemcell.cn Recombinant Human Precursor Brain-Derived Neurotrophic Factor BAFF cyt-307 Hystemcell.cn Recombinant Human BAFF (BLyS) BAFF His cyt-545 Hystemcell.cn Recombinant Human BAFF (BLyS), His Tag BAFF Plant cyt-054 Hystemcell.cn Recombinant Human BAFF (BLyS), Plant BAFF R cyt-429 Hystemcell.cn Recombinant Human BAFF (BLyS) Receptor BMPR1A cyt-380 Hystemcell.cn Recombinant Human Bone Morphogenetic protein Receptor-1A BMPR1A HEK cyt-713 Hystemcell.cn Recombinant Human Bone Morphogenetic protein Receptor-1A HEK BMP 2 cyt-261 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-2 BMP 2 HEK cyt-080 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-2, HEK BMP 2 Mono cyt-627 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-2 Monomer Pro BMP 2 cyt-427 Hystemcell.cn Recombinant Human Pro Bone Morphogenetic protein-2 BMP 4 cyt-361 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-4 BMP 4 Active cyt-081 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-4 Active BMP 5 cyt-660 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-5 BMP 7 cyt-333 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7 BMP 7 His cyt-629 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7 His Tag BMP 7 CHO cyt-276 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7, CHO BMP 7 Plant cyt-039 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7, Plant BMP 7 HEK cyt-082 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7, HEK b NGF cyt-579 Hystemcell.cn Recombinant Human beta Nerve Growth Factor b NGF CHO cyt-246 Hystemcell.cn Recombinant Human beta Nerve Growth Factor, CHO b NGF HEK cyt-079 Hystemcell.cn Recombinant Human beta Nerve Growth Factor, HEK mb NGF cyt-581 Hystemcell.cn Recombinant Mouse beta Nerve Growth Factor mb NGF cyt-440 Mouse beta Nerve Growth Factor ProNGF cyt-426 Hystemcell.cn Recombinant Human Pro-Nerve Growth Factor BNP cyt-327 Hystemcell.cn Recombinant Human B-type Natriuretic Protein BNP His cyt-605 Hystemcell.cn Recombinant Human B-type Natriuretic Protein His Tag BNP cyt-369 Human B-type Natriuretic Protein BST2 cyt-059 Hystemcell.cn Recombinant Human Bone Marrow Stromal Cell Antigen 2 BTC cyt-330 Hystemcell.cn Recombinant Human Betacellulin BTC His cyt-077 Hystemcell.cn Recombinant Human Betacellulin, His Tag mBTC cyt-131 Hystemcell.cn Recombinant Mouse Betacellulin bBTC cyt-406 Hystemcell.cn Recombinant Bovine Betacellulin CDNF cyt-167 Hystemcell.cn Recombinant Human Cerebral Dopamine Neurotrophic Factor mCDNF cyt-729 Hystemcell.cn Recombinant Mouse Cerebral Dopamine Neurotrophic Factor rCDNF cyt-730 Hystemcell.cn Recombinant Rat Cerebral Dopamine Neurotrophic Factor CLCF1 cyt-071 Hystemcell.cn Recombinant Human Cardiotrophin-Like Cytokine Factor 1 CNTF cyt-272 Hystemcell.cn Recombinant Human Ciliary Neurotrophic Factor CNTF His cyt-573 Hystemcell.cn Recombinant Human Ciliary Neurotrophic Factor, His Tag mCNTF cyt-139 Hystemcell.cn Recombinant Mouse Ciliary Neurotrophic Factor rCNTF cyt-654 Hystemcell.cn Recombinant Rat Ciliary Neurotrophic Factor CT 1 cyt-436 Hystemcell.cn Recombinant Human Cardiotrophin-1 mCT 1 cyt-151 Hystemcell.cn Recombinant Mouse Cardiotrophin-1 rCT 1 cyt-199 Hystemcell.cn Recombinant Rat Cardiotrophin-1 CTGF cyt-541 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor CTGF His cyt-438 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor, His Tag CTGF (182-250 a.a.) cyt-526 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor 182-250 a.a. CTGF HEK cyt-687 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor, HEK CTLA 4 cyt-366 Hystemcell.cn Recombinant Human Cytotoxic T-Lymphocyte Associated Antigen-4 CYR61 cyt-164 Hystemcell.cn Recombinant Human Cysteine-Rich Angiogenic Inducer 61 EBI3 cyt-367 Hystemcell.cn Recombinant Human Epstein Barr Virus Induced 3 EBI3 His cyt-668 Hystemcell.cn Recombinant Human Epstein Barr Virus Induced 3, His Tag mEBI3 cyt-621 Hystemcell.cn Recombinant Mouse Epstein Barr Virus Induced 3 EG VEGF cyt-338 Hystemcell.cn Recombinant Human Endocrine Gland Vacular Endothelial Growth Factor EGF cyt-217 Hystemcell.cn Recombinant Human Epidermal Growth Factor EGF Pichia cyt-332 Hystemcell.cn Recombinant Human Epidermal Growth Factor, Pichia EGF (Leu 21) cyt-466 Hystemcell.cn Recombinant Human Epidermal Growth Factor 21-Leu mEGF cyt-326 Hystemcell.cn Recombinant Mouse Epidermal Growth Factor mEGF cyt-554 Mouse Epidermal Growth Factor mEGF, His cyt-138 Hystemcell.cn Recombinant Mouse Epidermal Growth Factor, His rEGF cyt-556 Rat Epidermal Growth Factor rEGF cyt-669 Hystemcell.cn Recombinant Rat Epidermal Growth Factor EMAP II cyt-607 Hystemcell.cn Recombinant Human Endothelial-Monocyte Activating Polypeptide II AIMP1 cyt-021 Hystemcell.cn Recombinant Human Aminoacyl tRNA Synthetase Complex-Interacting Multifunctional Protein 1 Endoglin Sf9 cyt-389 Hystemcell.cn Recombinant Human Endoglin, Sf9 Endoglin cyt-525 Hystemcell.cn Recombinant Human Endoglin mEndoglin cyt-424 Hystemcell.cn Recombinant Mouse Endoglin EPGN cyt-601 Hystemcell.cn Recombinant Human Epigen EREG cyt-609 Hystemcell.cn Recombinant Human Epiregulin EPO a cyt-201 Hystemcell.cn Recombinant Human Erythropoietin-alpha EPO a Fc cyt-325 Hystemcell.cn Recombinant Human Erythropoietin-alpha Fc/Chimera EPO a HEK cyt-083 Hystemcell.cn Recombinant Human Erythropoietin-alpha, HEK FAS cyt-125 Hystemcell.cn Recombinant Human sFas Receptor FASLG cyt-031 Hystemcell.cn Recombinant Human FAS Ligand FASLG HEK cyt-051 Hystemcell.cn Recombinant Human FAS Ligand, HEK FGF 1 cyt-264 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-acidic FGF 1 Sf9 cyt-364 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-acidic, Sf9 mFGF 1 cyt-528 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-acidic mFGF 1 His cyt-072 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-acidic, His Tag rFGF 1 cyt-075 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-acidic baFGF cyt-613 Bovine Fibroblast Growth Factor-acidic FGF 2 cyt-218 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic FGF 2 Sf9 cyt-365 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic, Sf9 FGF 2 (147 a.a.) cyt-557 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic (147 a.a) FGF 2 293 Cells cyt-085 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic, 293 Cells FGF2 Plant cyt-123 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic, Plant bFGF 2 cyt-288 Hystemcell.cn Recombinant Bovine Fibroblast Growth Factor-basic bFGF 2 cyt-560 Bovine Fibroblast Growth Factor-basic mFGF 2 cyt-386 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-basic rFGF 2 cyt-608 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-basic FGF 4 cyt-312 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-4 FGF 4 HEK cyt-084 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-4, HEK FGF 8 cyt-714 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-8 mFGF 8 cyt-070 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-8 FGF 8 HEK cyt-087 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-8, HEK FGF 9 cyt-415 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-9 mFGF 9 cyt-349 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-9 rFGF 9 cyt-558 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-9 FGF12 cyt-620 Hystemcell.cn Recombinant Human Fibroblast Growth Factor 12 FGF13 cyt-121 Hystemcell.cn Recombinant Human Fibroblast Growth Factor 13 mFGF-15 cyt-027 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-15 FGF-18 cyt-120 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-18 mFGF-18 cyt-064 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-18 rFGF-18 cyt-176 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-18 FGF 19 cyt-700 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-19 FGF 19 His cyt-279 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-19 His Tag FGF 21 cyt-474 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-21 FGF 21 His cyt-281 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-21, His Tag mFGF 21 cyt-339 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-21 mFGF 21 His cyt-516 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-21, His Tag rFGF 21 cyt-130 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-21 bFGF 21 cyt-657 Hystemcell.cn Recombinant Bovine Fibroblast Growth Factor-21 FGF 22 cyt-428 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-22 FGF 23 cyt-020 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-23 FGF 23 His cyt-374 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-23 His Tag FGF 23 C-term cyt-028 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-23 C-Terminal Flt3 Ligand cyt-331 Hystemcell.cn Recombinant Human Flt3-Ligand Flt3 Ligand HEK cyt-706 Hystemcell.cn Recombinant Human Flt3-Ligand, HEK Flt3 Ligand Sf9 cyt-409 Hystemcell.cn Recombinant Human Flt3-Ligand, Sf9 mFlt3 Ligand cyt-340 Hystemcell.cn Recombinant Mouse Flt3-Ligand rmFlt3 Ligand cyt-157 Hystemcell.cn Recombinant Rhesus Macaque Flt3-Ligand FST cyt-232 Hystemcell.cn Recombinant Human Follistatin FST His cyt-029 Hystemcell.cn Recombinant Human Follistatin His Tag mFST cyt-124 Hystemcell.cn Recombinant Mouse Follistatin HB-EGF cyt-119 Hystemcell.cn Recombinant Human Proheparin-Binding EGF-like Growth Factor mHB-EGF cyt-068 Hystemcell.cn Recombinant Mouse Proheparin-Binding EGF-like Growth Factor rHB-EGF cyt-170 Hystemcell.cn Recombinant Rat Proheparin-Binding EGF-like Growth Factor LGALS1 cyt-544 Hystemcell.cn Recombinant Human Galectin-1 mLGALS1 cyt-186 Hystemcell.cn Recombinant Mouse Galectin-1 LGALS2 cyt-725 Hystemcell.cn Recombinant Human Galectin-2 mLGALS2 cyt-019 Hystemcell.cn Recombinant Mouse Galectin-2 LGALS3 cyt-606 Hystemcell.cn Recombinant Human Galectin-3 LGALS3 His cyt-693 Hystemcell.cn Recombinant Human Galectin-3 His Tag mLGALS3 cyt-188 Hystemcell.cn Recombinant Mouse Galectin-3 LGALS4 cyt-686 Hystemcell.cn Recombinant Human Galectin-4 mLGALS4 cyt-187 Hystemcell.cn Recombinant Mouse Galectin-4 LGALS7 cyt-016 Hystemcell.cn Recombinant Human Galectin-7 LGALS7 His cyt-617 Hystemcell.cn Recombinant Human Galectin-7 His Tag mLGALS7 cyt-184 Hystemcell.cn Recombinant Mouse Galectin-7 LGALS8 cyt-017 Hystemcell.cn Recombinant Human Galectin-8 LGALS8 His cyt-727 Hystemcell.cn Recombinant Human Galectin-8, His Tag mLGALS8 cyt-185 Hystemcell.cn Recombinant Mouse Galectin-8 LGALS9 cyt-708 Hystemcell.cn Recombinant Human Galectin-9 mLGALS9 cyt-550 Hystemcell.cn Recombinant Mouse Galectin-9 LGALS13 cyt-004 Hystemcell.cn Recombinant Human Galectin-13 LGALS14 cyt-003 Hystemcell.cn Recombinant Human Galectin-14 LGALSL cyt-073 Hystemcell.cn Recombinant Human Galectin-Related Protein GDNF cyt-305 Hystemcell.cn Recombinant Human Glial-Derived Neurotrophic Factor GDF3 cyt-694 Hystemcell.cn Recombinant Human Growth and Differentiation factor 3 GDF5 cyt-442 Hystemcell.cn Recombinant Human Growth and Differentiation factor 5 GDF5 His cyt-653 Hystemcell.cn Recombinant Human Growth and Differentiation factor 5 His Tag GDF10 cyt-659 Hystemcell.cn Recombinant Human Growth and Differentiation factor 10 GDF15 His cyt-691 Hystemcell.cn Recombinant Human Growth and Differentiation factor 15, His Tag GDF15 D cyt-314 Hystemcell.cn Recombinant Human Growth and Differentiation factor 15 D-Vairant GDF15 cyt-335 Hystemcell.cn Recombinant Human Growth and Differentiation factor 15 G CSF cyt-220 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor G CSF His cyt-476 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor, His Tag G CSF CHO cyt-329 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor, CHO G CSF PEG cyt-018 Hystemcell.cn Recombinant Human Pegylated Granulocyte-Colony Stimulating Factor G CSF HEK cyt-088 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor, HEK mG CSF cyt-410 Hystemcell.cn Recombinant Mouse Granulocyte-Colony Stimulating Factor GH cyt-202 Hystemcell.cn Recombinant Human Growth Hormone pGH 22kDa cyt-235 Hystemcell.cn Recombinant Human Placental Corr Growth Hormone GH 20kDa cyt-259 Hystemcell.cn Recombinant Human Pituitary Growth Hormone 20kDa pGH 20kDa cyt-337 Hystemcell.cn Recombinant Human Placental Growth Hormone 20kDa GH Plant cyt-053 Hystemcell.cn Recombinant Human Growth Hormone, Plant GH HEK cyt-091 Hystemcell.cn Recombinant Human Growth Hormone, HEK GHBP cyt-238 Hystemcell.cn Recombinant Human Growth Hormone Binding Protein oGHBP cyt-470 Hystemcell.cn Recombinant Ovine Growth Hormone Binding Protein bGHBP cyt-471 Hystemcell.cn Recombinant Bovine Growth Hormone Binding Protein raGHBP cyt-593 Hystemcell.cn Recombinant Rabbit Growth Hormone Binding Protein chGH cyt-430 Hystemcell.cn Recombinant Chicken Growth Hormone oGH cyt-237 Hystemcell.cn Recombinant Ovine Growth Hormone oGH Placental cyt-594 Hystemcell.cn Recombinant Placental Ovine Growth Hormone bGH cyt-636 Hystemcell.cn Recombinant Bovine Growth Hormone mGH cyt-540 Hystemcell.cn Recombinant Mouse Growth Hormone rGH cyt-296 Hystemcell.cn Recombinant Rat Growth Hormone cGH cyt-297 Hystemcell.cn Recombinant Carp Growth Hormone dGH cyt-498 Hystemcell.cn Recombinant Denis Growth Hormone maiGH cyt-499 Hystemcell.cn Recombinant Mai Mai Growth Hormone sGH cyt-529 Hystemcell.cn Recombinant Gilthead Seabream Growth Hormone raGH cyt-514 Hystemcell.cn Recombinant Rabbit Growth Hormone pGH cyt-519 Hystemcell.cn Recombinant Porcine Growth Hormone chGH Antagonist cyt-538 Hystemcell.cn Recombinant Chicken Growth Hormone Anatagonist oGH Antagonist cyt-215 Hystemcell.cn Recombinant Ovine Growth Hormone Anatagonist zGH cyt-710 Hystemcell.cn Recombinant Zebrafish Growth Hormone zGH Mutant cyt-709 Hystemcell.cn Recombinant Zebrafish Growth Hormone Mutant GM CSF cyt-221 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor GM CSF Pichia cyt-324 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Pichia GM CSF Sf9 cyt-416 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Sf9 GM CSF HEK cyt-089 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, HEK GM CSF His cyt-477 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, His Tag PIXY321 cyt-360 Hystemcell.cn Recombinant Human gm-csf/IL-3 Fusion Protein (PIXY321) mGM CSF cyt-222 Hystemcell.cn Recombinant Mouse Granulocyte Macrophage-Colony Stimulating Factor rGM CSF cyt-395 Hystemcell.cn Recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor pGM CSF cyt-401 Hystemcell.cn Recombinant Porcine Granulocyte Macrophage-Colony Stimulating Factor rmGM CSF cyt-720 Hystemcell.cn Recombinant Rhesus Macaque Granulocyte Macrophage-Colony Stimulating Factor k9GM CSF cyt-724 Hystemcell.cn Recombinant Canine Granulocyte Macrophage-Colony Stimulating Factor GMF b cyt-565 Hystemcell.cn Recombinant Human Glia Maturation Factor Beta GMF b His cyt-726 Hystemcell.cn Recombinant Human Glia Maturation Factor Beta His Tag mGMF b cyt-006 Hystemcell.cn Recombinant Mouse Glia Maturation Factor Beta rGMF b cyt-049 Hystemcell.cn Recombinant Rat Glia Maturation Factor Beta GMFG cyt-632 Hystemcell.cn Recombinant Human Glia Maturation Factor Gamma HDGF cyt-681 Hystemcell.cn Recombinant Human Hepatoma-Derived Growth Factor HDGF2 cyt-132 Hystemcell.cn Recombinant Human Hepatoma-Derived Growth Factor-2 HGF CHO cyt-251 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor, CHO HGF Sf9 cyt-244 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor, Sf9 HGF HEK cyt-090 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor, HEK HGF-A cyt-664 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor A Chain HGF-B cyt-665 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor B Chain pHGF cyt-522 Porcine Hepatocyte Promoting Growth Factor IFI30 cyt-183 Hystemcell.cn Recombinant Human Interferon Gamma-Inducible protein 30 IFN a 1 cyt-291 Hystemcell.cn Recombinant Human Interferon-alpha 1 IFN a 1a cyt-520 Hystemcell.cn Recombinant Human Interferon-alpha 1a IFN a 1b cyt-283 Hystemcell.cn Recombinant Human Interferon-alpha 1b IFN a 2a cyt-204 Hystemcell.cn Recombinant Human Interferon-alpha 2a IFN a 2a Plant cyt-543 Hystemcell.cn Recombinant Human Interferon-alpha 2a, Tobacco IFN a 2b cyt-205 Hystemcell.cn Recombinant Human Interferon-alpha 2b IFN a 2b Yeast cyt-460 Hystemcell.cn Recombinant Human Interferon-alpha 2b, Saccharomyces IFN a 2b 20kd-PEG cyt-034 Hystemcell.cn Recombinant Human Interferon-alpha 2b 20kd-Pegylated IFN a 2b HEK cyt-092 Hystemcell.cn Recombinant Human Interferon-alpha 2b, HEK IFN a 2a HEK cyt-093 Hystemcell.cn Recombinant Human Interferon-alpha 2a, HEK IFNA7 cyt-196 Hystemcell.cn Recombinant Human Interferon-alpha 7 IFNA14 cyt-135 Hystemcell.cn Recombinant Human Interferon-alpha 14 IFN b 1a cyt-236 Hystemcell.cn Recombinant Human Interferon-beta 1a IFN b 1b cyt-234 Hystemcell.cn Recombinant Human Interferon-beta 1b mIFN b His cyt-651 Hystemcell.cn Recombinant Mouse Interferon-beta His Tag IFN g cyt-206 Hystemcell.cn Recombinant Human Interferon-gamma IFN g His cyt-478 Hystemcell.cn Recombinant Human Interferon-gamma His Tag mIFN g cyt-358 Hystemcell.cn Recombinant Mouse Interferon-gamma rIFN g cyt-359 Hystemcell.cn Recombinant Rat Interferon-gamma pIFN g cyt-402 Hystemcell.cn Recombinant Porcine Interferon-gamma qIFN g cyt-739 Hystemcell.cn Recombinant Equine Interferon-gamma IFNW1 cyt-040 Hystemcell.cn Recombinant Human Interferon-Omega 1 oIFN tau cyt-377 Hystemcell.cn Recombinant Ovine Interferon-Tau IRF 1 cyt-449 Hystemcell.cn Recombinant Human Interferon Regulatory Factor-1 IRF 2 cyt-534 Hystemcell.cn Recombinant Human Interferon Regulatory Factor-2 IRF 3 cyt-292 Hystemcell.cn Recombinant Human Interferon Regulatory Factor-3 IGF1 cyt-216 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1 IGF1 GST cyt-690 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1, GST-Tag IGF1 Des1-3 cyt-518 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1 Des (1-3) Long R3 IGF1 cyt-022 Hystemcell.cn Recombinant Human LR3 Insulin Like Growth Factor-1 IGF1 N15 cyt-128 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1 N15 Labeled mIGF1 cyt-229 Hystemcell.cn Recombinant Mouse Insulin Like Growth Factor-1 rIGF1 cyt-289 Hystemcell.cn Recombinant Rat Insulin Like Growth Factor-1 sIGF1 cyt-295 Hystemcell.cn Recombinant Gilthead Seabream Insulin Like Growth Factor-1 IGF2 cyt-265 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-2 pro-IGF2 cyt-110 Hystemcell.cn Recombinant Human Pro-Insulin Like Growth Factor-2 IGFBP 1 cyt-299 Human Insulin Like Growth Factor Binding Protein-1 IGFBP 3 cyt-300 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-3 IGFBP 4 cyt-030 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-4 IGFBP 5 cyt-464 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-5 IGFBP 6 cyt-258 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-6 IHH cyt-195 Hystemcell.cn Recombinant Human Indian Hedgehog IL 1 alpha cyt-253 Hystemcell.cn Recombinant Human Interleukin-1 alpha IL 1 alpha His cyt-479 Hystemcell.cn Recombinant Human Interleukin-1 alpha, His Tag mIL 1 alpha cyt-523 Hystemcell.cn Recombinant Mouse Interleukin-1 alpha rIL 1 alpha cyt-381 Hystemcell.cn Recombinant Rat Interleukin-1 alpha pIL 1 alpha cyt-396 Hystemcell.cn Recombinant Porcine Interleukin-1 alpha IL 1 beta cyt-208 Hystemcell.cn Recombinant Human Interleukin-1 beta IL 1 beta His cyt-480 Hystemcell.cn Recombinant Human Interleukin-1 beta, His Tag IL 1 beta HEK cyt-094 Hystemcell.cn Recombinant Human Interleukin-1 beta, HEK mIL 1 beta cyt-273 Hystemcell.cn Recombinant Mouse Interleukin-1 beta mIL 1 beta His cyt-578 Hystemcell.cn Recombinant Mouse Interleukin-1 beta, His Tag rIL 1 beta cyt-394 Hystemcell.cn Recombinant Rat Interleukin-1 beta pIL 1 beta cyt-400 Hystemcell.cn Recombinant Porcine Interleukin-1 beta rmIL 1 beta cyt-718 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-1 beta IL 1RA cyt-203 Hystemcell.cn Recombinant Human Interleukin-1 Receptor Antagonist IL 1RA His cyt-481 Hystemcell.cn Recombinant Human Interleukin-1 Receptor Antagonist, His Tag IL1RL1 cyt-671 Hystemcell.cn Recombinant Human Interleukin-1 Receptor Like-1 mIL 1RA cyt-658 Hystemcell.cn Recombinant Mouse Interleukin-1 Receptor Antagonist mIL 1RA His cyt-136 Hystemcell.cn Recombinant Mouse Interleukin-1 Receptor Antagonist, His Tag rIL 1RA cyt-152 Hystemcell.cn Recombinant Rat Interleukin-1 Receptor Antagonist hIL 1RA cyt-010 Hystemcell.cn Recombinant Horse Interleukin-1 Receptor Antagonist IL 2 cyt-209 Hystemcell.cn Recombinant Human Interleukin-2 IL 2 His cyt-666 Hystemcell.cn Recombinant Human Interleukin-2 His Tag IL 2 HEK cyt-095 Hystemcell.cn Recombinant Human Interleukin 2, HEK mIL 2 cyt-370 Hystemcell.cn Recombinant Mouse Interleukin-2 mIL 2 His cyt-624 Hystemcell.cn Recombinant Mouse Interleukin-2, His Tag rIL 2 cyt-382 Hystemcell.cn Recombinant Rat Interleukin-2 pIL 2 cyt-397 Hystemcell.cn Recombinant Porcine Interleukin-2 qIL2 cyt-738 Hystemcell.cn Recombinant Equine Interleukin-2 sIL 2R cyt-285 Hystemcell.cn Recombinant Human Soluble Iinterleukin-2 Receptor alpha IL 3 cyt-210 Hystemcell.cn Recombinant Human Interleukin-3 IL 3 His cyt-482 Hystemcell.cn Recombinant Human Interleukin-3, His Tag IL 3 HEK cyt-096 Hystemcell.cn Recombinant Human Interleukin 3, HEK mIL 3 cyt-371 Hystemcell.cn Recombinant Mouse Interleukin-3 rIL 3 cyt-383 Hystemcell.cn Recombinant Rat Interleukin-3 IL 3 Sf9 cyt-417 Hystemcell.cn Recombinant Human Interleukin-3, Sf9 k9 IL 3 cyt-722 Hystemcell.cn Recombinant Canine Interleukin-3 rmIL3 cyt-156 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-3 IL 4 cyt-211 Hystemcell.cn Recombinant Human Interleukin-4 IL 4 CHO cyt-271 Hystemcell.cn Recombinant Human Interleukin-4 CHO IL 4 His cyt-483 Hystemcell.cn Recombinant Human Interleukin-4, His Tag IL 4 HEK cyt-097 Hystemcell.cn Recombinant Human Interleukin 4, HEK mIL 4 cyt-282 Hystemcell.cn Recombinant Mouse Interleukin-4 rIL 4 cyt-385 Hystemcell.cn Recombinant Rat Interleukin-4 pIL 4 cyt-398 Hystemcell.cn Recombinant Porcine Interleukin-4 rmIL4 cyt-172 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-4 IL 5 cyt-212 Hystemcell.cn Recombinant Human Interleukin-5 mIL 5 cyt-689 Hystemcell.cn Recombinant Mouse Interleukin-5 rIL 5 cyt-387 Hystemcell.cn Recombinant Rat Interleukin-5 IL 6 cyt-213 Hystemcell.cn Recombinant Human Interleukin-6 IL 6 CHO cyt-274 Hystemcell.cn Recombinant Human Interleukin-6, CHO IL 6 His cyt-484 Hystemcell.cn Recombinant Human Interleukin-6, His Tag IL 6 HEK cyt-098 Hystemcell.cn Recombinant Human Interleukin 6, HEK mIL 6 cyt-350 Hystemcell.cn Recombinant Mouse Interleukin-6 rIL 6 cyt-388 Hystemcell.cn Recombinant Rat Interleukin-6 pIL 6 cyt-399 Hystemcell.cn Recombinant Porcine Interleukin-6 rmIL 6 cyt-174 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-6 sIL 6R cyt-286 Hystemcell.cn Recombinant Human Soluble IL-6 Receptor alpha IL 7 cyt-254 Hystemcell.cn Recombinant Human Interleukin-7 IL 7 Yeast cyt-298 Hystemcell.cn Recombinant Human Interleukin-7, Saccharomyces IL 7 His cyt-485 Hystemcell.cn Recombinant Human Interleukin-7, His Tag IL 7, HEK cyt-197 Hystemcell.cn Recombinant Human Interleukin-7, HEK mIL 7 cyt-372 Hystemcell.cn Recombinant Mouse Interleukin-7 rIL 7 cyt-163 Hystemcell.cn Recombinant Rat Interleukin-7 IL 9 cyt-348 Hystemcell.cn Recombinant Human Interleukin-9 IL 9 HEK cyt-099 Hystemcell.cn Recombinant Human Interleukin 9, HEK mIL 9 cyt-373 Hystemcell.cn Recombinant Mouse Interleukin-9 rIL 9 cyt-748 Hystemcell.cn Recombinant Rat Interleukin-9 IL 10 cyt-500 Hystemcell.cn Recombinant Human Interleukin-10 IL 10 His cyt-486 Hystemcell.cn Recombinant Human Interleukin-10, His Tag IL 10 HEK cyt-100 Hystemcell.cn Recombinant Human Interleukin 10, HEK mIL 10 cyt-497 Hystemcell.cn Recombinant Mouse Interleukin-10 rIL 10 cyt-465 Hystemcell.cn Recombinant Rat Interleukin-10 pIL 10 cyt-404 Hystemcell.cn Recombinant Porcine Interleukin-10 IL 11 cyt-214 Hystemcell.cn Recombinant Human Interleukin-11 IL 11 Pichia cyt-013 Hystemcell.cn Recombinant Human Interleukin-11, Pichia mIL 11 cyt-646 Hystemcell.cn Recombinant Mouse Interleukin-11 IL 12 cyt-101 Hystemcell.cn Recombinant Human Interleukin 12 IL 12 p35 His cyt-487 Hystemcell.cn Recombinant Human Interleukin-12 p35, His Tag IL 12 p40 Baculovirus cyt-134 Hystemcell.cn Recombinant Human Interleukin-12 p40, Baculovirus IL 12 p40 His cyt-488 Hystemcell.cn Recombinant Human Interleukin-12 p40, His Tag IL 12 p40 Plant cyt-056 Hystemcell.cn Recombinant Human Interleukin-12 p40, Plant mIL 12 cyt-144 Hystemcell.cn Recombinant Mouse Interleukin-12 rIL 12 cyt-390 Hystemcell.cn Recombinant Rat Interleukin-12 IL 13 cyt-446 Hystemcell.cn Recombinant Human Interleukin-13 IL 13 Variant cyt-682 Hystemcell.cn Recombinant Human Interleukin-13 Variant IL 13 His cyt-489 Hystemcell.cn Recombinant Human Interleukin-13, His Tag mIL 13 cyt-375 Hystemcell.cn Recombinant Mouse Interleukin-13 rIL 13 cyt-391 Hystemcell.cn Recombinant Rat Interleukin-13 rIL 13 109 a.a. cyt-182 Hystemcell.cn Recombinant Rat Interleukin-13 109 a.a. rmIL 13 cyt-175 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-13 IL 15 cyt-230 Hystemcell.cn Recombinant Human Interleukin-15 IL 15 His cyt-490 Hystemcell.cn Recombinant Human Interleukin-15, His Tag mIL 15 cyt-344 Hystemcell.cn Recombinant Mouse Interleukin-15 mIL 15 His cyt-647 Hystemcell.cn Recombinant Mouse Interleukin-15, His Tag rIL 15 cyt-345 Hystemcell.cn Recombinant Rat Interleukin-15 pIL 15 cyt-403 Hystemcell.cn Recombinant Porcine Interleukin-15 IL 16, (130 a.a.) cyt-536 Hystemcell.cn Recombinant Human Interleukin-16, (130 a.a.) IL 16, (121 a.a.) cyt-142 Hystemcell.cn Recombinant Human Interleukin-16, (121 a.a.) IL 16 His cyt-562 Hystemcell.cn Recombinant Human Interleukin-16, His Tag mIL 16 cyt-559 Hystemcell.cn Recombinant Mouse Interleukin-16 maIL 16 cyt-153 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-16 IL 17A cyt-250 Hystemcell.cn Recombinant Human Interleukin-17A IL 17A His cyt-662 Hystemcell.cn Recombinant Human Interleukin-17A His Tag IL 17A HEK cyt-102 Hystemcell.cn Recombinant Human Interleukin 17A, HEK IL 17E cyt-583 Hystemcell.cn Recombinant Human Interleukin-17E IL 17F cyt-587 Hystemcell.cn Recombinant Human Interleukin-17F IL 17F HEK cyt-103 Hystemcell.cn Recombinant Human Interleukin 17F, HEK IL 17 A/F cyt-623 Hystemcell.cn Recombinant Human Interleukin-17 A/F Heterodimer mIL 17 cyt-378 Hystemcell.cn Recombinant Mouse Interleukin-17A mIL 17E cyt-641 Hystemcell.cn Recombinant Mouse Interleukin-17E mIL 17F cyt-642 Hystemcell.cn Recombinant Mouse Interleukin-17F mIL 17 A/F cyt-640 Hystemcell.cn Recombinant Mouse Interleukin-17 A/F Heterodimer rIL 17 A/F cyt-677 Hystemcell.cn Recombinant Rat Interleukin-17 A/F Heterodimer rIL 17 cyt-542 Hystemcell.cn Recombinant Rat Interleukin-17A rIL 17E cyt-576 Hystemcell.cn Recombinant Rat Interleukin-17E rIL 17F cyt-643 Hystemcell.cn Recombinant Rat Interleukin-17F IL 18 cyt-269 Hystemcell.cn Recombinant Human Interleukin-18 IL 18 His cyt-663 Hystemcell.cn Recombinant Human Interleukin-18 His Tag IL18BP cyt-728 Hystemcell.cn Recombinant Human Interleukin-18 Binding Protein mIL 18 cyt-634 Hystemcell.cn Recombinant Mouse Interleukin-18 rIL 18 cyt-376 Hystemcell.cn Recombinant Rat Interleukin-18 IL 19 cyt-363 Hystemcell.cn Recombinant Human Interleukin-19 mIL 19 cyt-411 Hystemcell.cn Recombinant Mouse Interleukin-19 IL 20 cyt-347 Hystemcell.cn Recombinant Human Interleukin-20 mIL 20 cyt-379 Hystemcell.cn Recombinant Mouse Interleukin-20 IL 21 cyt-408 Hystemcell.cn Recombinant Human Interleukin-21 mIL 21 cyt-684 Hystemcell.cn Recombinant Mouse Interleukin-21 rIL 21 cyt-033 Hystemcell.cn Recombinant Rat Interleukin-21 IL 22 cyt-328 Hystemcell.cn Recombinant Human Interleukin-22 mIL 22 cyt-539 Hystemcell.cn Recombinant Mouse Interleukin-22 rIL 22 cyt-173 Hystemcell.cn Recombinant Rat Interleuikin-22 mIL 22 PEG cyt-701 Hystemcell.cn Recombinant Mouse Interleukin-22, Pegylated mIL 22A cyt-148 Hystemcell.cn Recombinant Mouse Interleukin-22 Antagonist (E117A) IL 23 cyt-050 Hystemcell.cn Recombinant Human Interleukin-23 IL 23 His cyt-067 Hystemcell.cn Recombinant Human Interleukin-23, His Tag IL 24 cyt-515 Hystemcell.cn Recombinant Human Interleukin-24 IL 27 cyt-048 Hystemcell.cn Recombinant Human Interleukin-27 p28 mIL 27 cyt-570 Hystemcell.cn Recombinant Mouse Interleukin-27 IL 28A cyt-602 Hystemcell.cn Recombinant Human Interleukin-28A IL 28A HEK cyt-104 Hystemcell.cn Recombinant Human Interleukin-28A, HEK mIL 28A cyt-741 Hystemcell.cn Recombinant Mouse Interleukin-28A IL 28B cyt-105 Hystemcell.cn Recombinant Human Interleukin-28B mIL 28B cyt-732 Hystemcell.cn Recombinant Mouse Interleukin-28B IL 29 cyt-603 Hystemcell.cn Recombinant Human Interleukin-29 IL 29 HEK cyt-117 Hystemcell.cn Recombinant Human Interleukin-29, HEK IL 31 cyt-625 Hystemcell.cn Recombinant Human Interleukin-31 mIL 31 cyt-604 Hystemcell.cn Recombinant Mouse Interleukin-31 IL 32A cyt-584 Hystemcell.cn Recombinant Human IL-32 alpha IL 32A His Tag cyt-648 Hystemcell.cn Recombinant Human IL-32 alpha His Tag IL 33 cyt-425 Hystemcell.cn Recombinant Human Interleukin-33 IL 33 His cyt-667 Hystemcell.cn Recombinant Human Interleukin-33 His Tag mIL 33 cyt-655 Hystemcell.cn Recombinant Mouse Interleukin-33 rIL 33 cyt-150 Hystemcell.cn Recombinant Rat Interleukin-33 IL34 cyt-042 Hystemcell.cn Recombinant Human Interleukin-34 IL36RN cyt-009 Hystemcell.cn Recombinant Human Interleukin-36 Receptor Antagonist mIL36RN cyt-154 Hystemcell.cn Recombinant Mouse Interleukin-36 Receptor Antagonist IL36A cyt-158 Hystemcell.cn Recombinant Human Interleukin-36 Alpha IL36A 158 a.a. cyt-179 Hystemcell.cn Recombinant Human Interleukin-36 Alpha 158 a.a. mIL36A cyt-162 Hystemcell.cn Recombinant Mouse Interleukin-36 Alpha mIL36A 153 a.a. cyt-181 Hystemcell.cn Recombinant Mouse Interleukin-36 Alpha 153 a.a. IL36B cyt-159 Hystemcell.cn Recombinant Human Interleukin-36 Beta IL36B 153 a.a. cyt-180 Hystemcell.cn Recombinant Human Interleukin-36 Beta 153 a.a mIL36B cyt-165 Hystemcell.cn Recombinant Mouse Interleukin-36 Beta IL36G cyt-160 Hystemcell.cn Recombinant Human Interleukin-36 Gamma IL36G 152 a.a. cyt-161 Hystemcell.cn Recombinant Human Interleukin-36 Gamma 152 a.a. mIL36G cyt-745 Hystemcell.cn Recombinant Mouse Interleukin-36 Gamma IL37 cyt-011 Hystemcell.cn Recombinant Human Interleukin 37 IL1F10 cyt-012 Hystemcell.cn Recombinant Human Interleukin 1 Family, Member 10 Insulin cyt-270 Hystemcell.cn Recombinant Human Insulin Insulin Yeast cyt-614 Hystemcell.cn Recombinant Human Insulin Yeast pInsulin cyt-468 Porcine Insulin KGF cyt-219 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor mKGF cyt-721 Hystemcell.cn Recombinant Mouse Keratinocyte Growth Factor KGF HEK cyt-086 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor, HEK KGF 2 cyt-303 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor-2 KGF 2 His cyt-129 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor-2, His Tag mKGF 2 cyt-126 Hystemcell.cn Recombinant Mouse Keratinocyte Growth Factor-2 rKGF cyt-127 Hystemcell.cn Recombinant Rat Keratinocyte Growth Factor-2 Leptin cyt-228 Hystemcell.cn Recombinant Human Leptin Leptin cyt-683 Human Leptin Leptin His cyt-287 Hystemcell.cn Recombinant Human Leptin, His Tag mLeptin cyt-351 Hystemcell.cn Recombinant Mouse Leptin mLeptin PEG cyt-591 Hystemcell.cn Recombinant Pegylated Mouse Leptin rLeptin cyt-227 Hystemcell.cn Recombinant Rat Leptin rLeptin PEG cyt-592 Hystemcell.cn Recombinant Pegylated Rat Leptin oLeptin cyt-239 Hystemcell.cn Recombinant Ovine Leptin oLeptin, MTS cyt-531 Hystemcell.cn Recombinant Ovine Leptin, MTS tag bLeptin cyt-502 Hystemcell.cn Recombinant Bovine Leptin pLeptin cyt-503 Hystemcell.cn Recombinant Porcine Leptin pfLeptin cyt-530 Hystemcell.cn Recombinant Pufferfish Leptin sLeptin cyt-704 Hystemcell.cn Recombinant Salamander Leptin hLeptin cyt-504 Hystemcell.cn Recombinant Horse Leptin chLeptin cyt-505 Hystemcell.cn Recombinant Chicken Leptin dLeptin cyt-506 Hystemcell.cn Recombinant Dog Leptin raLeptin cyt-507 Hystemcell.cn Recombinant Rabbit Leptin Leptin tA cyt-352 Hystemcell.cn Recombinant Human Leptin Triple Antagonist Leptin tA PEG cyt-702 Hystemcell.cn Recombinant Human Leptin Triple Antagonist, Pegylated Leptin qA cyt-353 Hystemcell.cn Recombinant Human Leptin Quadruple Antagonist mLeptin tA cyt-354 Hystemcell.cn Recombinant Mouse Leptin Triple Antagonist mLeptin tA PEG cyt-566 Hystemcell.cn Recombinant Pegylated Mouse Leptin Triple Antagonist, Pegylated rLeptin tA cyt-355 Hystemcell.cn Recombinant Rat Leptin Triple Antagonist rLeptin tA PEG cyt-567 Hystemcell.cn Recombinant Pegylated Rat Leptin Triple Antagonist, Pegylated oLeptin tA cyt-356 Hystemcell.cn Recombinant Ovine Leptin Triple Antagonist oLeptin tA PEG cyt-703 Hystemcell.cn Recombinant Ovine Leptin Triple Antagonist, Pegylated oLeptin qA cyt-357 Hystemcell.cn Recombinant Ovine Leptin Quadruple Antagonist Leptin Receptor cyt-508 Hystemcell.cn Recombinant Human Leptin Binding Domain chLeptin Receptor cyt-509 Hystemcell.cn Recombinant Chicken Leptin Binding Domain LFA 3 cyt-423 Hystemcell.cn Recombinant Human Leukocyte Function Associated Antigen-3 Fusion Protein LIF cyt-644 Hystemcell.cn Recombinant Human Leukemia Inhibitory Factor mLIF cyt-645 Hystemcell.cn Recombinant Mouse Leukemia Inhibitory Factor LIF GST cyt-001 Hystemcell.cn Recombinant Human Leukemia Inhibitory Factor, GST tag rLIF cyt-731 Hystemcell.cn Recombinant Rat Leukemia Inhibitory Factor MANF, His cyt-133 Hystemcell.cn Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor, His Tag MANF cyt-141 Hystemcell.cn Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor M CSF cyt-308 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor M CSF Baculovirus cyt-637 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor, Baculovirus M CSF HEK cyt-106 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor, HEK M CSF His cyt-695 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor, His Tag mM CSF cyt-439 Hystemcell.cn Recombinant Mouse Macrophage Colony Stimulating Factor rM CSF cyt-046 Hystemcell.cn Recombinant Rat Macrophage Colony Stimulating Factor MIF cyt-575 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor MIF (Active) cyt-596 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor MIF His N cyt-431 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor, His Tag N-Terminus MIF His C cyt-521 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-Terminus mMIF cyt-744 Hystemcell.cn Recombinant Mouse Macrophage Migration Inhibitor Factor rMIF cyt-193 Hystemcell.cn Recombinant Rat Macrophage Migration Inhibitor Factor MIA cyt-310 Hystemcell.cn Recombinant Human Melanoma Inhibitory Activity Protein MIA2 cyt-638 Hystemcell.cn Recombinant Human Melanoma Inhibitory Activity Protein 2 Midkine cyt-192 Hystemcell.cn Recombinant Human Midkine Midkine, His cyt-444 Hystemcell.cn Recombinant Human Midkine, His Tag mMidkine cyt-178 Hystemcell.cn Recombinant Mouse Midkine rMidkine cyt-747 Hystemcell.cn Recombinant Rat Midkine MTPN cyt-723 Hystemcell.cn Recombinant Human Myotrophin Myostatin cyt-418 Hystemcell.cn Recombinant Human Myostatin Myostatin His cyt-445 Hystemcell.cn Recombinant Human Myostatin, His-Tag Myostatin Propetide cyt-448 Hystemcell.cn Recombinant Human Myostatin Propeptide Myostatin Plant cyt-055 Hystemcell.cn Recombinant Human Myostatin, Plant NGB cyt-450 Hystemcell.cn Recombinant Human Neuroglobin NRG1 cyt-407 Hystemcell.cn Recombinant Human Neuregulin-1/Heregulin-b2 NRG1 B1 cyt-733 Hystemcell.cn Recombinant Human Neuregulin-1/Heregulin-b1 NRG1 A cyt-736 Hystemcell.cn Recombinant Human Neuregulin-1/Heregulin Alpha (EGF Domain) NT 3 cyt-257 Hystemcell.cn Recombinant Human Neurotrophin-3 proNT3 cyt-015 Hystemcell.cn Recombinant Human Precursor Neurotrophin-3 mNT 3 cyt-688 Hystemcell.cn Recombinant Mouse Neurotrophin-3 NT 4 cyt-626 Hystemcell.cn Recombinant Human Neurotrophin-4 Noggin cyt-475 Hystemcell.cn Recombinant Human Noggin Noggin HEK cyt-107 Hystemcell.cn Recombinant Human Noggin, HEK mNoggin cyt-600 Hystemcell.cn Recombinant Mouse Noggin Omentin cyt-301 Hystemcell.cn Recombinant Human Omentin Omentin His cyt-551 Hystemcell.cn Recombinant Human Omentin His Tag Omentin 298 a.a. cyt-061 Hystemcell.cn Recombinant Human Omentin 298 a.a. OPG Fc cyt-266 Hystemcell.cn Recombinant Human Osteoprotegerin/Fc Chimera OPG cyt-177 Hystemcell.cn Recombinant Human Osteoprotegerin OPG His cyt-290 Hystemcell.cn Recombinant Human Osteoprotegerin, His Tag OPG Hi-5 cyt-633 Hystemcell.cn Recombinant Human Osteoprotegerin Hi-5 OSM cyt-231 Hystemcell.cn Recombinant Human Oncostatin-M OSM (209 a.a.) cyt-639 Hystemcell.cn Recombinant Human Oncostatin-M (209 a.a.) OSM (195 a.a.) cyt-735 Hystemcell.cn Recombinant Human Oncostatin-M (195 a.a.) OSM, His cyt-060 Hystemcell.cn Recombinant Human Oncostatin-M, His Tag OSM HEK cyt-108 Hystemcell.cn Recombinant Human Oncostatin-M, HEK mOSM cyt-168 Hystemcell.cn Recombinant Mouse Oncostatin-M rOSM cyt-169 Hystemcell.cn Recombinant Rat Oncostatin-M OSTF1 cyt-630 Hystemcell.cn Recombinant Human Osteoclast Stimulating Factor-1 OTOR cyt-582 Hystemcell.cn Recombinant Human Otoraplin PDGF AA cyt-341 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AA PDGF AA Yeast cyt-568 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AA, Yeast PDGF AA HEK cyt-109 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AA HEK PDGF A cyt-491 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-A mPDGF AA cyt-590 Hystemcell.cn Recombinant Mouse Plaet Derived Growth Factor-AA PDGF AB cyt-342 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AB PDGF BB cyt-501 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-BB PDGF B cyt-492 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-B mPDGF BB cyt-412 Hystemcell.cn Recombinant Mouse Plaet Derived Growth Factor-BB rPDGF BB cyt-740 Hystemcell.cn Recombinant Rat Plaet Derived Growth Factor-BB PDGFD cyt-155 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-D PDGFRA cyt-065 Hystemcell.cn Recombinant Human Plaet-Derived Growth Factor Receptor, Alpha PEDF cyt-580 Hystemcell.cn Recombinant Human Pigment Epithelium-Derived Factor PEDF His cyt-552 Hystemcell.cn Recombinant Human Pigment Epithelium-Derived Factor, His Tag PEDF HEK cyt-553 Hystemcell.cn Recombinant Human Pigment Epithelium-Derived Factor, HEK Periostin cyt-452 Hystemcell.cn Recombinant Human Periostin PGRN cyt-524 Hystemcell.cn Recombinant Human Progranulin Pleiotrophin cyt-451 Hystemcell.cn Recombinant Human Pleiotrophin Pleiotrophin HEK cyt-198 Hystemcell.cn Recombinant Human Pleiotrophin, HEK Placental Lactogen cyt-656 Hystemcell.cn Recombinant Human Placental Lactogen bPlacental Lactogen cyt-511 Hystemcell.cn Recombinant Bovine Placental Lactogen oPlacental Lactogen cyt-512 Hystemcell.cn Recombinant Ovine Placental Lactogen cPlacental Lactogen cyt-510 Hystemcell.cn Recombinant Caprine Placental Lactogen PLGF 1 cyt-419 Hystemcell.cn Recombinant Human Placenta Growth Factor-1 PLGF 2 cyt-420 Hystemcell.cn Recombinant Human Placenta Growth Factor-2 Prolactin cyt-267 Hystemcell.cn Recombinant Human Prolactin Prolactin His cyt-493 Hystemcell.cn Recombinant Human Prolactin, His Tag mProlactin cyt-321 Hystemcell.cn Recombinant Mouse Prolactin rProlactin cyt-322 Hystemcell.cn Recombinant Rat Prolactin oProlactin cyt-240 Hystemcell.cn Recombinant Ovine Prolactin raProlactin cyt-513 Hystemcell.cn Recombinant Rabbit Prolactin Prl R, GST cyt-469 Hystemcell.cn Recombinant Human Prolactin Receptor , GST Tag Prl R cyt-595 Hystemcell.cn Recombinant Human Prolactin Receptor raPrl R cyt-268 Hystemcell.cn Recombinant Rabbit Prolactin Soluble Receptor oPrl R cyt-293 Hystemcell.cn Recombinant Ovine Prolactin Soluble Receptor bPrl R cyt-294 Hystemcell.cn Recombinant Bovine Prolactin Soluble Receptor tPrl R cyt-532 Hystemcell.cn Recombinant Raibow Trout Prolactin Soluble Receptor rPrl R cyt-533 Hystemcell.cn Recombinant Rat Prolactin Soluble Receptor oPrl A cyt-311 Hystemcell.cn Recombinant Ovine Prolactin Antagonist oPrl A Mutant cyt-705 Hystemcell.cn Recombinant Ovine Prolactin Antagonist, Mutant sCD4 cyt-304 Hystemcell.cn Recombinant Human Soluble CD4 CD4 (26-226) cyt-313 Hystemcell.cn Recombinant Human CD4 (26-226) CD4 (125-202) cyt-315 Hystemcell.cn Recombinant Human CD4 (125-202) CD4 (203-317) cyt-316 Hystemcell.cn Recombinant Human CD4 (203-317) sCD40L cyt-245 Hystemcell.cn Recombinant Human soluble CD40 Ligand/TRAP sCD40L His cyt-670 Hystemcell.cn Recombinant Human soluble CD40 Ligand/TRAP His Tag msCD40L cyt-472 Hystemcell.cn Recombinant Mouse soluble CD40 Ligand/TRAP SCGB1A1 cyt-743 Hystemcell.cn Recombinant Human Uteroglobin mSCGB1A1 cyt-746 Hystemcell.cn Recombinant Mouse Uteroglobin SHH cyt-676 Hystemcell.cn Recombinant Human Sonic HedgeHog SHH, His cyt-717 Hystemcell.cn Recombinant Human Sonic HedgeHog, His Tag mSHH cyt-597 Hystemcell.cn Recombinant Mouse Sonic HedgeHog mSHH, His cyt-711 Hystemcell.cn Recombinant Mouse Sonic HedgeHog, His Tag DHH cyt-467 Hystemcell.cn Recombinant Human Desert HedgeHog DHH (C23II) cyt-362 Hystemcell.cn Recombinant Human Desert HedgeHog (C23II) sRANKL cyt-334 Hystemcell.cn Recombinant Human Soluble RANK Ligand sRANKL His cyt-692 Hystemcell.cn Recombinant Human Soluble RANK Ligand, His Tag sRANKL GST cyt-631 Hystemcell.cn Recombinant Human Soluble RANK Ligand, GST Tag msRANKL cyt-320 Hystemcell.cn Recombinant Mouse Soluble RANK Ligand sRANK Receptor cyt-734 Hystemcell.cn Recombinant Human Soluble RANK Receptor mRELM a cyt-309 Hystemcell.cn Recombinant Mouse RELM-alpha mRELM a His cyt-453 Hystemcell.cn Recombinant Mouse RELM-alpha His Tag RELM b cyt-454 Hystemcell.cn Recombinant Human RELM-beta mRELM b cyt-413 Hystemcell.cn Recombinant Mouse RELM-beta mRELM g cyt-455 Hystemcell.cn Recombinant Mouse RELM-Gamma Resistin cyt-456 Hystemcell.cn Recombinant Human Resistin Resistin His cyt-256 Hystemcell.cn Recombinant Human Resistin, His Tag Resistin Mutant cyt-585 Hystemcell.cn Recombinant Human Resistin Mutant mResistin cyt-457 Hystemcell.cn Recombinant Mouse Resistin rResistin cyt-458 Hystemcell.cn Recombinant Rat Resistin RBP1 cyt-122 Hystemcell.cn Recombinant Human Retinol Binding Protein-1 RBP4 cyt-535 Hystemcell.cn Recombinant Human Retinol Binding Protein-4 RBP4 His cyt-555 Hystemcell.cn Recombinant Human Retinol Binding Protein-4 His Tag RBP5 cyt-650 Hystemcell.cn Recombinant Human Retinol Binding Protein-5 RBP7 cyt-023 Hystemcell.cn Recombinant Human Retinol Binding Protein-7 SAA1 cyt-675 Hystemcell.cn Recombinant Human Serum Amyloid A (APO-SAA1) rmSAA1 cyt-719 Hystemcell.cn Recombinant Rhesus Macaque Serum Amyloid A (APO-SAA1) SAA4 cyt-002 Hystemcell.cn Recombinant Human Serum Amyloid A4 SCF cyt-255 Hystemcell.cn Recombinant Human Stem Cell Factor mSCF cyt-275 Hystemcell.cn Recombinant Mouse Stem Cell Factor rSCF cyt-323 Hystemcell.cn Recombinant Rat Stem Cell Factor SCF Sf9 cyt-421 Hystemcell.cn Recombinant Human Stem Cell Factor, Sf9 SCF HEK cyt-111 Hystemcell.cn Recombinant Human Stem Cell Factor, HEK k9SCF cyt-194 Hystemcell.cn Recombinant Canine Stem Cell Factor SF20 cyt-622 Hystemcell.cn Recombinant Human Chromosome 19 Open Reading Frame 10 mSF20 cyt-678 Hystemcell.cn Recombinant Mouse Chromosome 19 Open Reading Frame 10 SPP1 cyt-635 Hystemcell.cn Recombinant Human Osteopontin SPP1 HEK cyt-047 Hystemcell.cn Recombinant Human Osteopontin, HEK TACI cyt-032 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor 13B TAFA2 cyt-118 Hystemcell.cn Recombinant Human Family with Sequence Similarity 19 Member A2 TDGF1 cyt-712 Hystemcell.cn Recombinant Human Teratocarcinoma-Derived Growth Factor 1 TFF1 cyt-586 Hystemcell.cn Recombinant Human Trefoil Factor-1 TFF1 His cyt-610 Hystemcell.cn Recombinant Human Trefoil Factor-1 His Tag TFF2 cyt-612 Hystemcell.cn Recombinant Human Trefoil Factor-2 TFF2 His cyt-611 Hystemcell.cn Recombinant Human Trefoil Factor-2 His Tag TFF3 cyt-005 Hystemcell.cn Recombinant Human Trefoil Factor-3 TFF3 His cyt-616 Hystemcell.cn Recombinant Human Trefoil Factor-3 His Tag TGF b 1 cyt-716 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1 TGF b 1 cyt-561 Human Transforming Growth Factor-Beta 1 TGF b 1 GST cyt-473 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1, GST tag TGF b 1 His cyt-672 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1 His Tag TGF b 1 (113 a.a.) cyt-679 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1 (113 a.a.) TGF b 2 cyt-441 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 2 TGF b 2 HEK cyt-112 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 2, HEK TGF b 3 cyt-368 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3 TGF b 3 CHO cyt-685 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3, CHO TGF b 3 Plant cyt-588 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3, Plant TGF b 3 HEK cyt-113 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3, HEK TGF b 3 (207 a.a.) cyt-319 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3 (644-850) mTGF b 3 cyt-143 Hystemcell.cn Recombinant Mouse Transforming Growth Factor-Beta 3 4 1BBR cyt-463 Hystemcell.cn Recombinant Human 4-1BB Receptor 4 1BBR, His cyt-137 Hystemcell.cn Recombinant Human 4-1BB Receptor His Tag 4 1BBL cyt-149 Hystemcell.cn Recombinant Human 4-1BB Ligand 4 1BBL, His cyt-649 Hystemcell.cn Recombinant Human 4-1BB Ligand, His Tag TNF a cyt-223 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha TNF a His cyt-494 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha, His Tag TNF a HEK cyt-114 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha, HEK mTNF a cyt-252 Hystemcell.cn Recombinant Mouse Tumor Necrosis Factor-alpha rTNF a cyt-393 Hystemcell.cn Recombinant Rat Tumor Necrosis Factor-alpha rpTNF a cyt-405 Hystemcell.cn Recombinant Porcine Tumor Necrosis Factor-alpha raTNF a cyt-008 Hystemcell.cn Recombinant Rabbit Tumor Necrosis Factor-alpha rCaTNF a cyt-140 Hystemcell.cn Recombinant Canine Tumor Necrosis Factor-alpha rmTNF a cyt-737 Hystemcell.cn Recombinant Rhesus Macaque Tumor Necrosis Factor-alpha TNF a Mutant cyt-384 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha, Mutant TNF b cyt-224 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-beta TNF b His cyt-495 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-beta, His Tag TNFR2 cyt-674 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor Type 2 TNFR2 Fc cyt-422 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor 2 Fusion Protein TNFRSF17 cyt-598 Hystemcell.cn Recombinant Human B-Cell Maturation Antigen TNFRSF17, His cyt-190 Hystemcell.cn Recombinant Human B-Cell Maturation Antigen, His Tag TNFR cyt-707 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor TNFR His cyt-673 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor Type His Tag TNFSF12 cyt-699 Hystemcell.cn Recombinant Human TNF Ligand Superfamily Member 12 TNFRSF10B cyt-069 Hystemcell.cn Recombinant Human TNF Ligand Receptor Superfamily Member 10B TNFRSF12A cyt-043 Hystemcell.cn Recombinant Human TNF Ligand Receptor Superfamily Member 12A TSLP cyt-572 Hystemcell.cn Recombinant Human Thymic Stromal Lymphopoietin TSLPR cyt-742 Hystemcell.cn Recombinant Human Thymic Stromal Lymphopoietin Receptor TPO cyt-302 Hystemcell.cn Recombinant Human Thrombopoietin TPO CHO cyt-462 Hystemcell.cn Recombinant Human Thrombopoietin, CHO TPO HEK cyt-115 Hystemcell.cn Recombinant Human Thrombopoietin, HEK mTPO cyt-346 Hystemcell.cn Recombinant Mouse Thrombopoietin TRAIL cyt-443 Hystemcell.cn Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L TRAIL (114-281 a.a.) cyt-546 Hystemcell.cn Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L (114-281) ULBP1 cyt-166 Hystemcell.cn Recombinant Human UL16 Binding Protein 1 Vaspin cyt-459 Hystemcell.cn Recombinant Human Vaspin VEGF cyt-241 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor VEGF His cyt-496 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, His Tag VEGF CHO cyt-260 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, CHO VEGF HEK cyt-225 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, HEK VEGF Yeast cyt-577 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, Yeast VEGF (121a.a.) cyt-343 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121) VEGF (121a.a.) Sf9 cyt-200 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121), Sf9 VEGF (121a.a.) His cyt-619 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121), His Tag VEGF (121a.a.) HEK cyt-116 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121), HEK rmVEGF cyt-336 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor mVEGF Sf9 cyt-226 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor-Sf9 rmVEGF (121a.a.) cyt-574 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor (121) rmVEGF His cyt-680 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor, His Tag rVEGF cyt-392 Hystemcell.cn Recombinant Rat Vascular Endothelial Growth Factor VEGFB cyt-628 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor B VEGF C cyt-527 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor Related Protein rVEGF C cyt-262 Hystemcell.cn Recombinant Rat Vascular Endothelial Growth Factor Related Protein rVEGF C (152a.a.) cyt-284 Hystemcell.cn Recombinant Rat Vascular Endothelial Growth Factor-C (152) VEGF D cyt-045 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor D VEGF E (Orf Virus) cyt-263 Hystemcell.cn Recombinant Vascular Endothelial Growth Factor-E (Orf Virus) VEGI cyt-517 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Inhibitor VEGI His cyt-589 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Inhibitor, His Tag Visfatin cyt-318 Hystemcell.cn Recombinant Human Visfatin Visfatin His cyt-563 Hystemcell.cn Recombinant Human Visfatin, His Tag mVisfatin cyt-447 Hystemcell.cn Recombinant Mouse Visfatin 重慶市華雅干細胞技術(shù)有限公司 : |