日本精品专区视频在线播放,国产精品观看不卡视频,精品久久久久精品三级18,亚洲区一区二区三区视频

服務(wù)熱線

15021010459
產(chǎn)品中心
當(dāng)前位置:主頁 > 產(chǎn)品中心 > > 抗體/抗原 >CD14 Human Recombinant HEK ProSpec品牌

CD14 Human Recombinant HEK ProSpec品牌

簡要描述:Monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14.

  • 產(chǎn)品型號(hào):PRO-1642
  • 廠商性質(zhì):代理商
  • 更新時(shí)間:2025-02-12
  • 訪  問  量:1591
詳細(xì)介紹

現(xiàn)貨供應(yīng),歡迎訂購:      :

CD14 Human Recombinant HEK

       10µg

       50µg

       1mg         

Catalogue Number

      PRO-1642

Synonyms        Monocyte

 differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14.

Introduction

      CD14 (also known lipopolysaccharide (LPS) receptor) is expressed strongly on monocytes and macrophage and weakly on the surface of neutrophils. CD14 is anchored to cells by linkage to glycosylphosphatidylinositol (GPI) and functions as a high affinity receptor for complexes of LPS and LPS binding protein (LBP). Soluble CD14, also binding to LPS, acts at physiological concentration as an LPS agonist and has, at higher concentrations, an LPS antagonizing effect in cell activation. CD14 has been shown to bind apoptotic cells.

Description

      CD14 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 341 amino acids (20-352). CD14 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.

Source

      HEK293 cells.

Physical Appearance   Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

      CD14 was lyophilized from a 0.2 µM filtered solution of 20mM PB and 150mM NaCl, PH 7.4.

Solubility

      It is recommended to reconstitute the lyophilized CD14 in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Stability

      Lyophilized CD14 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD14 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Purity

      Greater than 95% as determined by SDS-PAGE.

Amino acid sequence        TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVD

ADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKIT

GTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELWLKPGLKVLSIAQAHSPAF

SCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCA

ALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKL

RVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACVDHHHHHH

Usage

      ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. Related Products   CHEMOKINES

Related Products

ABI3     pro-1227     Recombinant Human ABI Family, Member 3

A2LD1  pro-172       Recombinant Human AIG2-Like Domain 1

A2M      pro-551       Human Alpha-2 Macroglobulin Protein

ACTA2 pro-1220     Recombinant Human Actin, Alpha 2, Smooth Muscle, Aorta

ACTG1 pro-377       Recombinant Human Actin Gamma 1

Actin     pro-517       Actin

ACTL6A      pro-379       Recombinant Human Actin-Like 6A

ADAM10     pro-476       Recombinant Human A Disintegrin and Metalloproteinase Domain 10

ADAM12     pro-474       Recombinant Human A Disintegrin and Metalloproteinase Domain 12 S Isoform

ADFP   pro-405       Recombinant Human Adipose Differentiation-Related Protein

Adipsin       pro-1360     Recombinant Human Complement Factor D

ADRM1       pro-1079     Recombinant Human Adhesion Regulating Molecule 1

AES      pro-169       Recombinant Human Amino-Terminal Enhancer of Split

AFP      pro-406       Human Alpha Fetoprotein

Ag85A  pro-1076     Recombinant Mycobacterium Tuberculosis major secretory protein Antigen 85A

Ag85B  pro-589       Recombinant Mycobacterium Tuberculosis major secretory protein Antigen 85B

AGR2   pro-580       Recombinant Human Anterior Gradient Protein 2 Homolog

AGR3   pro-242       Recombinant Human Anterior Gradient Protein 3 Homolog

AHSP   pro-720       Recombinant Human Alpha Hemoglobin Stabilizing Protein

AIDA     pro-1370     Recombinant Human Axin Interactor Dorsalization Associated

AIP pro-886       Recombinant Human Aryl Hydrocarbon Receptor Interacting Protein

ALK/P80     pro-455       Recombinant Human ALK-P80

Alpha Actinin    pro-518       Alpha Actinin

AMBP   pro-407       Human Alpha-1 Microglobulin

AMBP   pro-957       Recombinant Human Alpha-1 Microglobulin

AMELX       pro-1324     Recombinant Human Amelogenin, X-Linked

AMN     pro-1330     Recombinant Human Amnion Associated Transmembrane Protein

AMTN   pro-1301     Recombinant Human Amelotin

ANAPC13  pro-1037     Recombinant Human Anaphase Promoting Complex Subunit 13

Angiostatin K1-3     pro-284       Recombinant Human Angiostatin Kringles 1-3

Angiostatin K1-4     pro-604       Human Angiostatin Kringles 1-4

ANKRD1    pro-1219     Recombinant Human Ankyrin Repeat Domain 1

ANP32A     pro-252       Recombinant Human Acidic Nuclear Phosphoprotein 32 Family, Member A

ANXA1 pro-679       Recombinant Human Annexin A1

ANXA10     pro-1045     Recombinant Human Annexin A10

ANXA11     pro-278       Recombinant Human Annexin A11

ANXA13     pro-197       Recombinant Human Annexin A13

ANXA2 pro-777       Recombinant Human Annexin A2

ANXA3 pro-765       Recombinant Human Annexin A3

ANXA4 pro-766       Recombinant Human Annexin A4

ANXA5 pro-732       Recombinant Human Annexin A5

ANXA5 Sf9       pro-137       Recombinant Human Annexin A5, Sf9

ANXA6 pro-767       Recombinant Human Annexin A6

ANXA7 pro-449       Recombinant Human Annexin A7

ANXA8 pro-548       Recombinant Human Annexin A8

ANXA8L2   pro-1138     Recombinant Human Annexin A8 Like-2

ANXA9 pro-450       Recombinant Human Annexin A9

AP1S2 pro-234       Recombinant Human Adaptor-Related Protein Complex 1, Sigma 2

AP2M1 pro-451       Recombinant Human Assembly Protein Complex 2

AP3S1 pro-1280     Recombinant Human Assembly Protein Complex 3 Subunit-1

AP3S2 pro-452       Recombinant Human Assembly Protein Complex 3 Subunit-2

APCS   pro-453       Recombinant Human Amyloid P Component

APIP     pro-1186     Recombinant Human APAF1 interacting protein

Apo Transferrin       pro-325       Human Apo Transferrin

APP      pro-1080     Recombinant Human Amyloid beta (A4) Precursor Protein

bApo Transferrin     pro-511       Bovine Apo Transferrin

bAprotinin  pro-285       Bovine Aprotinin

bAprotinin  pro-414       Recombinant Bovine Aprotinin

APTX    pro-790       Recombinant Human Aprataxin

ARC     pro-1403     Recombinant Human Activity-Regulated Cytoskeleton-Associated Protein

ARF1    pro-867       Recombinant Human ADP-Ribosylation Factor 1

ARF3    pro-933       Recombinant Human ADP-Ribosylation Factor 3

ARF4    pro-066       Recombinant Human ADP-Ribosylation Factor 4

ARF5    pro-245       Recombinant Human ADP-Ribosylation Factor 5

ARF6    pro-032       Recombinant Human ADP-Ribosylation Factor 6

ARFIP2       pro-1201     Recombinant Human ADP-Ribosylation Factor Interacting Protein 2

ARHGDIA   pro-002       Recombinant Human Rho GDP Dissociation Inhibitor (GDI) Alpha

ARHGDIB   pro-1067     Recombinant Human Rho GDP Dissociation Inhibitor (GDI) Beta

ARL1    pro-508       Recombinant Human ADP-Ribosylation Factor-Like 1

ARL11  pro-884       Recombinant Human ADP-Ribosylation Factor-Like 11

ARL14  pro-936       Recombinant Human ADP-Ribosylation Factor-Like 14

ARL15  pro-956       Recombinant Human ADP-Ribosylation Factor-Like 15

ARL2    pro-074       Recombinant Human ADP-Ribosylation Factor-Like 2

ARL2BP     pro-274       Recombinant Human ADP-Ribosylation Factor-Like 2 Binding Protein

ARL3    pro-939       Recombinant Human ADP-Ribosylation Factor-Like 3

ARL4A pro-895       Recombinant Human ADP-Ribosylation Factor-Like 4A

ARL4D pro-953       Recombinant Human ADP-Ribosylation Factor-Like 4D

ARL5A pro-040       Recombinant Human ADP-Ribosylation Factor-Like 5A

ARL5B pro-897       Recombinant Human ADP-Ribosylation Factor-Like 5B

ARL6    pro-232       Recombinant Human ADP-Ribosylation Factor-Like 6

ARL9    pro-1009     Recombinant Human ADP-Ribosylation Factor-Like 9

ARPC2       pro-1398     Recombinant Human Actin Related Protein 2/3 Complex, Subunit 2

ARPC5       pro-145       Recombinant Human Actin Related Protein 2/3 Complex, Subunit 5

ARPC3       pro-1413     Recombinant Human Actin Related Protein 2/3 Complex, Subunit 3

ASF1A pro-682       Recombinant Human ASF1 Anti-Silencing Function 1 Homolog A

ASF1B pro-1163     Recombinant Human ASF1 Anti-Silencing Function 1 Homolog B

ASGR2       pro-1261     Recombinant Human Asialoglycoprotein Receptor 2

ASNA1 pro-1247     Recombinant Human arsA Arsenite Transporter, ATP-Binding, Homolog 1

ATG10  pro-1234     Recombinant Human Autophagy Related 10

ATG4B pro-1048     Recombinant Human ATG4 Autophagy Related 4 Homolog B

ATG5    pro-454       Recombinant Human Autophagy Related 5

ATOH1 pro-1073     Recombinant Human Atonal Homolog 1

ATOX1 pro-754       Recombinant Human Copper Transport Protein ATOX1

ATPIF1 pro-1154     Recombinant Human ATPase Inhibitory Factor 1

ATXN3 pro-708       Recombinant Human Ataxin-3

Avidin   pro-500       Avidin

Avidin-Biotin     pro-446       Modified Affinity Purified Avidin

B2GP1 pro-388       Recombinant Human Beta 2 Glycoprotein-I

B2GP1 pro-552       Human Beta 2 Glycoprotein-I

B2M      pro-337       Recombinant Human Beta 2 Microglobulin

B2M      pro-553       Human Beta 2 Microglobulin

B2M His      pro-859       Recombinant Human Beta 2 Microglobulin, His Tag

BAALC pro-758       Recombinant Human Brain and Acute Leukemia, Cytoplasmatic

BAD      pro-458       Recombinant Human BAD

BAG1   pro-817       Recombinant Human BCL2-Associated Athanogene 1

BAG2   pro-168       Recombinant Human BCL2-Associated Athanogene 2

BAG3   pro-760       Recombinant Human BCL2-Associated Athanogene 3

BAIAP2       pro-1022     Recombinant Human BAI1-Associated Protein 2

BASP1 pro-1355     Recombinant Human Brain Abundant Membrane Attached Signal Protein 1

BATF    pro-119       Recombinant Human Basic Leucine Zipper Transcription Factor

Batroxobin  pro-607       Recombinant Batroxobin

mBAX   pro-412       Recombinant Mouse Bax

mBAX GST pro-647       Recombinant Mouse Bax GST Tag

bCAPN2     pro-330       Bovine Calpain-2 Catalytic Subunit

BCAS2 pro-116       Recombinant Human Breast Carcinoma Amplified Sequence 2

BCDIN3D   pro-1262     Recombinant Human BCDIN3D

BCL10  pro-1058     Recombinant Human B-cell CLL/Lymphoma 10

Bcl-2    pro-630       Recombinant Human B-Cell Leukemia/Lymphoma 2

Bcl-2 -BH1  pro-631       Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH1

Bcl-2 -BH2  pro-632       Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH2

Bcl-2 -BH3  pro-633       Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH3

Bcl-2 -BH4  pro-411       Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH4

BCL2 His    pro-683       Recombinant Human B-Cell Lymphoma Protein 2 Alpha, His Tag

Bcl-2 -NWGR    pro-634       Recombinant Human B-Cell Leukemia/Lymphoma 2 -NWGR

BCL2A1      pro-1102     Recombinant Human BCL2-Related Protein A1

BCL2L10    pro-1321     Recombinant Human BCL2 Like 10

BCL2L11    pro-1171     Recombinant Human BCL2 Like 11

BCL2L2      pro-768       Recombinant Human BCL2 Like 2

BCL6    pro-460       Recombinant Human B-cell CLL/lymphoma 6

BCL7A pro-1318     Recombinant Human B-cell CLL/lymphoma 7A

Bcl-XL  pro-639       Recombinant Human B-Cell Leukemia/Lymphoma XL

Bcl-XL GST       pro-640       Recombinant Human B-Cell Leukemia/Lymphoma XL GST Tag

Bcl-XL His  pro-641       Recombinant Human B-Cell Leukemia/Lymphoma His Tag

mBcl-XL      pro-1362     Recombinant Mouse B-Cell Leukemia/Lymphoma XL

bECGS       pro-603       Bovine Endothelial Mitogen

BECN1       pro-1289     Recombinant Human Beclin 1, Autophagy Related

BGN     pro-1382     Recombinant Human Biglycan

bFibronectin     pro-059       Bovine Fibronectin

bHolo Transferrin    pro-510       Bovine Holo Transferrin

BID       pro-627       Recombinant Human BH3 Interacting Domain Death Agonist

mBID    pro-642       Recombinant Mouse BH3 Interacting Domain Death Agonist

mBID GST  pro-643       Recombinant Mouse BH3 Interacting Domain Death Agonist GST

mtBID   pro-644       Recombinant Mouse BH3 Interacting Domain Death Agonist p15

BIN1     pro-546       Recombinant Human Bridging Integrator 1

BIRC5  pro-613       Recombinant Human Baculoviral IAP Repeat-Containing 5

BIRC7  pro-612       Recombinant Human Baculoviral IAP Repeat-Containing 7

BIRC7 (1-280)  pro-1042     Recombinant Human Baculoviral IAP Repeat-Containing 7 (1-280 a.a.)

Bivalirudin  pro-357       Human Bivalirudin

BLNK   pro-102       Recombinant Human B-Cell Linker

BLOC1S2   pro-1094     Recombinant Human Biogenesis of Lysosomal Organelles Complex-1, Subunit 2

BMF      pro-700       Recombinant Human Bcl2 Modifying Factor, Isoform 3

bNEFM       pro-523       Bovine Neurofilament Medium Polypeptide  

BOLA1 pro-302       Recombinant Human BolA Homolog 1 

BP-1     pro-463       Recombinant Human BP-1

BPI pro-129       Human Bactericidal/Permeability-Increasing Protein

BPIFA1       pro-404       Recombinant Human BPI fold containing family A Member 1

BSA      pro-422       Bovine Serum Albumin

bSNRPD    pro-998       Bovine Small Nuclear Ribonucleoprotein Polypeptide

BTF3    pro-1333     Recombinant Human Basic Transcription Factor 3

BUB3   pro-023       Recombinant Human BUB3

bThrombin  pro-447       Bovine Thrombin

bTROVE2   pro-111       Bovine TROVE Domain Family, Member 2

bTrypsin      pro-313       Recombinant Bovine Trypsin

bVimentin   pro-525       Bovine Vimentin

C7ORF49   pro-1415     Recombinant Human Chromosome 7 Open Reading Frame 49

C12ORF5   pro-051       Recombinant Human Chromosome 12 Open Reading Frame 5

C14ORF129     pro-193       Recombinant Human Chromosome 14 Open Reading Frame 129

C16ORF53 pro-225       Recombinant Human Chromosome 16 Open Reading Frame 53

C17ORF49 pro-1192     Recombinant Human Chromosome 17 Open Reading Frame 49

C1q       pro-554       Human Complement Component C1q

C1QBP       pro-636       Recombinant Human Complement Component  1

C1QTNF1   pro-654       Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 1

C1QTNF2   pro-133       Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 2

C1QTNF3   pro-653       Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 3

C1QTNF6   pro-655       Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 6

C1QTNF7   pro-514       Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 7

C1QTNF8   pro-134       Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 8

C1QTNF9   pro-135       Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 9

C20ORF20 pro-1000     Recombinant Human Chromosome 20 Open Reading Frame 20

C3c       pro-555       Human Complement Component C3c

C4BPB pro-1174     Recombinant Human Complement Component 4 Binding Protein, Beta

C4c       pro-556       Human Complement Component C4c

mC5a   pro-085       Recombinant Mouse Complement Component C5a

C6ORF108 pro-249       Recombinant Human Chromosome 6 Open Reading Frame 108

C8G      pro-947       Recombinant Human Complement Component 8, Gamma

C9ORF103 pro-1025     Recombinant Human Chromosome 9 Open Reading Frame 103

C9ORF95   pro-1116     Recombinant Human Chromosome 9 Open Reading Frame 95

CAB39 pro-857       Recombinant Human Calcium Binding Protein 39

CAB39L      pro-020       Recombinant Human Calcium Binding Protein 39 Like

CABP7 pro-211       Recombinant Human Calcium Binding Protein 7

CACYBP    pro-831       Recombinant Human Calcyclin Binding Protein

Cadherin-E       pro-461       Recombinant Human Cadherin-E

CALB1 pro-721       Recombinant Human Calbindin-1

CALB2 pro-401       Recombinant Human Calbindin-2

mCALB2     pro-290       Recombinant Mouse Calbindin-2

CALM2 pro-618       Recombinant Human Calmodulin-2

CALM2 135 a.a.      pro-370       Recombinant Human Calmodulin-2 135 a.a.

CALML3     pro-1323     Recombinant Human Calmodulin Like 3

CALN1 pro-279       Recombinant Human Calnueron-1

CALR   pro-813       Recombinant Human Calreticulin

Calumenin pro-696       Recombinant Human Calumenin

CAMP  pro-1405     Recombinant Human Cathelicidin Antimicrobial Peptide

CANT1 pro-1010     Recombinant Human Calcium Activated Nucleotidase 1

CANX   pro-725       Recombinant Human Calnexin

CAPG   pro-759       Recombinant Human Capping Protein Gelsolin-Like

CAPN1       pro-363       Human Calpain-1 Catalytic Subunit

CAPS   pro-117       Recombinant Human Calcyphosine

CAPSL pro-185       Recombinant Human Calcyphosine-Like

CARD18     pro-1061     Recombinant Human Caspase Recruitment Domain Family, Member 18

Cardiac Actin    pro-519       Cardiac Actin

CARHSP1  pro-257       Recombinant Human Calcium Regulated Heat Stable Protein 1

CASQ2       pro-799       Recombinant Human Calsequestrin

CBFB   pro-534       Recombinant Human Core Binding Factor Beta

CBX1   pro-876       Recombinant Human Chromobox Homolog 1

CBX3   pro-1057     Recombinant Human Chromobox Homolog 3

CBX5   pro-1062     Recombinant Human Chromobox Homolog 5

CCDC43     pro-1398     Recombinant Human Coiled-Coil Domain Containing 43

CCDC101  pro-1063     Recombinant Human Coiled-Coil Domain Containing 101

CCND2       pro-1012     Recombinant Human Cyclin D2

CCNG1       pro-1005     Recombinant Human Cyclin G1

CCS     pro-251       Recombinant Human Copper Chaperone for Superoxide Dismutase

CD11b pro-472       Recombinant Human CD11b

CD14-CHO       pro-536       Recombinant Human CD14 CHO derived

mCD14       pro-537       Recombinant Mouse CD14

CD1B   pro-1267     Recombinant Human CD1B

CD2      pro-1337     Recombinant Human CD2

CD2 GST    pro-468       Recombinant Human CD2, GST Tag

CD23    pro-470       Recombinant Human CD23

CD226 pro-1353     Recombinant Human CD226

CD244 pro-1173     Recombinant Human CD244

CD247 pro-1335     Recombinant Human CD247

CD27    pro-1213     Recombinant Human CD27

CD274 pro-1103     Recombinant Human CD274

mCD274     pro-1164     Recombinant Mouse CD274

CD300C     pro-273       Recombinant Human CD300C

CD30    pro-1369     Recombinant Human CD30

CD3G   pro-1392     Recombinant Human CD3 Gamma

CD34 GST  pro-292       Recombinant Human CD34 GST Tag

CD34   pro-1363     Recombinant Human CD34

CD3e    pro-1317     Recombinant Human CD3e

CD45    pro-482       Recombinant Human CD45

CD46    pro-1414     Recombinant Human CD46

CD56    pro-483       Recombinant Human CD56

CD68    pro-1209     Recombinant Human CD68

CD68, 38 kda    pro-293       Recombinant Human CD68, 38kda

CD72    pro-486       Recombinant Human CD72

CD79B pro-1304     Recombinant Human CD79B

CD83    pro-019       Recombinant Human CD83

CD84    pro-1229     Recombinant Human CD84

CD95 His    pro-594       Recombinant Human CD95, His Tag

CD99    pro-294       Recombinant Human CD99

CDC26 pro-241       Recombinant Human Cell Division Cycle  26

CDC37 pro-464       Recombinant Human Cell Division Cycle  37

CDC37, His       pro-140       Recombinant Human Cell Division Cycle  37, His Tag

CDC42 pro-727      Recombinant Human Cell Division Cycle  42

CDCA8       pro-222       Recombinant Human Cell Division Cycle Associated 8

CDH11 pro-1368     Recombinant Human Cadherin 11

CEA      pro-287       Recombinant Human Carcinoembryonic Antigen

CEBP-a      pro-433       Recombinant Human CCAAT/enhancer binding protein(C/EBP) Alpha

CEBP-g      pro-434       Recombinant Human CCAAT/enhancer binding protein(C/EBP) Gamma

CENPA       pro-389       Recombinant Human Centromere Protein-A

CENPB       pro-390       Recombinant Human Centromere Protein-B

CENPH       pro-966       Recombinant Human Centromere Protein-H

CETN1 pro-1104     Recombinant Human Centrin-1

CETN2 pro-060       Recombinant Human Centrin-2

CETN3 pro-533       Recombinant Human Centrin-3

CFL1    pro-591       Recombinant Human Cofilin-1

CFL2    pro-912       Recombinant Human Cofilin-2

CFLAR pro-920       Recombinant Human CASP8 and FADD-Like Apoptosis Regulator

CHD4   pro-112       Recombinant Human Chromodomain Helicase DNA Binding Protein 4

CHGA  pro-692       Recombinant Human Chromogranin A

CHGA GST       pro-491       Recombinant Human Chromogranin A GST Tag

CHGA His  pro-699       Recombinant Human Chromogranin A His Tag

CHGB  pro-824       Recombinant Human Chromogranin B

CHMP1A    pro-1308     Recombinant Human Chromatin Modifying Protein 1A

CHMP1B    pro-1117     Recombinant Human Charged Multivesicular Body Protein 1B

CHMP2A    pro-503       Recombinant Human Chromatin Modifying Protein 2A

CHMP2B    pro-877       Recombinant Human Chromatin Modifying Protein 2B

CHMP4A    pro-1024     Recombinant Human Chromatin Modifying Protein 4A

CHMP5       pro-1232     Recombinant Human Charged Multivesicular Body Protein 5

CHMP6       pro-1085     Recombinant Human Charged Multivesicular Body Protein 6

CHP1   pro-847       Recombinant Human Calcium Binding Protein P22

CHRAC1    pro-1391     Recombinant Human Chromatin Accessibility Complex 1

CIAO1  pro-1396     Recombinant Human Cytosolic Iron-Sulfur Protein Assembly 1

CIAPIN1     pro-024       Recombinant Human Cytokine Induced Apoptosis Inhibitor 1

CIRBP  pro-746       Recombinant Human Cold Inducible RNA Binding Protein

CISD1  pro-1221     Recombinant Human CDGSH Iron Sulfur Domain 1

CITED2       pro-701       Recombinant Human Cbp/p300-Interacting Transactivator 2

CLDN4 pro-203       Recombinant Human Claudin-4

CLEC2B     pro-526       Recombinant Human C-type Lectin Domain Family 2, Member B

CLIC1   pro-833       Recombinant Human Chloride Intracellular Channel 1

CLIC2   pro-198       Recombinant Human Chloride Intracellular Channel 2

CLIC4   pro-173       Recombinant Human Chloride Intracellular Channel 4

CLNS1A     pro-1277     Recombinant Human Chloride Channel, Nucleotide-Sensitive, 1A

CLTA    pro-1144     Recombinant Human Clathrin, Light Chain A

CLTB    pro-1172     Recombinant Human Clathrin, Light Chain B

CNBP   pro-1371     Recombinant Human Cellular Nucleic Acid Binding Protein

CNN1   pro-1129     Recombinant Human Calponin 1, Basic, Smooth Muscle

CNPY3       pro-1386     Recombinant Human Canopy 3 Homolog 

mCNOT7    pro-908       Recombinant Mouse CCR4-NOT Transcription Complex, Subunit 7

CNRIP1      pro-1214     Recombinant Human Cannabinoid Receptor Interacting Protein 1

COL4A3      pro-387       Recombinant Human Collagen Type IV Alpha 3

COL4A3BP       pro-837       Recombinant Human Collagen Type IV Alpha 3 Binding Protein

Collagen     pro-359       Recombinant Human Like Collagen

Collagen-3 pro-480       Recombinant Human Collagen-3

COMMD1   pro-862       Recombinant Human Copper Metabolism Domain Containing 1

COMMD9   pro-1244     Recombinant Human COMM Domain Containing 9

COMP HEK       pro-132       Recombinant Human Cartilage Oligomeric Matrix Protein, HEK

COPS8       pro-983       Recombinant Human COP9 Constitutive Photomorphogenic 8

COPZ1 pro-221       Recombinant Human Coatomer Protein Complex, Subunit Zeta 1

COTL1 pro-064       Recombinant Human Coactosin-Like 1

COX4NB    pro-917       Recombinant Human COX4NB

COX5A       pro-1331     Recombinant Human Cytochrome C Oxidase Subunit Va

CPLX1 pro-645       Recombinant Human Complexin-1

CPSF4 pro-1406     Recombinant Human Cleavage And Polyadenylation Specific Factor 4

CRABP1     pro-710       Recombinant Human Cellular Retinoic Acid Binding Protein 1  

CRABP2     pro-637       Recombinant Human Cellular Retinoic Acid binding Protein 2

CRADD      pro-465       Recombinant Human Caspase and RIP Adapter with Death Domain

CRCP  pro-919       Recombinant Human CGRP Receptor Component

CREG1       pro-1196     Recombinant Human Cellular Repressor of E1A-Stimulated Genes 1

CRIPT  pro-1105     Recombinant Human Cysteine-Rich PDZ-Binding Protein

CRISP1      pro-473       Recombinant Human Cysteine-Rich Secretory Protein 1

CRK     pro-275       Recombinant Human V-crk Sarcoma Virus CT10 Oncogene

CRKL   pro-063       Recombinant Human V-crk Sarcoma Virus CT10 Oncogene Homolog (Avian)-Like

CRMP-1      pro-493       Recombinant Human Collapsin Response Mediator Protein-1

CRNN  pro-797       Recombinant Human Cornulin

CRP     pro-335       Recombinant Human C-Reactive Protein

CRP     pro-557       Human C-Reactive Protein

CRP (19-224 a.a.)   pro-914       Recombinant Human C-Reactive Protein (19-224 a.a.)

CRYGC      pro-1095     Recombinant Human Crystallin, Gamma C

CRYGD      pro-913       Recombinant Human Crystallin, Gamma D

CRYGN      pro-1152     Recombinant Human Crystallin, Gamma N

CRYGS       pro-963       Recombinant Human Crystallin, Gamma S

CSN2   pro-1047     Recombinant Human Casein Beta

CSRP2       pro-1096     Recombinant Human Cysteine and Glycine-rich Protein 2

CST1    pro-1006     Recombinant Human Cystatin SN

CST3    pro-656       Recombinant Human Cystatin C

CST3    pro-413       Human Cystatin C

mCST3 pro-597       Recombinant Mouse Cystatin-C

rCST3   pro-438       Recombinant Rat Cystatin C

CST3 Active      pro-961       Recombinant Human Cystatin C Active

CST4    pro-1097     Recombinant Human Cystatin 4

CST6    pro-892       Recombinant Human Cystatin E/M

CST9    pro-955       Recombinant Human Cystatin 9

CSTA   pro-086       Recombinant Human Cystatin-A

CSTA GST pro-543       Recombinant Human Cystatin-A, GST tag

CSTA His   pro-504       Recombinant Human Cystatin-A His Tag

CSTB   pro-609       Recombinant Human Cystatin-B

CSTF1 pro-1170     Recombinant Human Cleavage Stimulation Factor 1

CTBP1 pro-796       Recombinant Human C-Terminal Binding Protein 1

CTNNBIP1 pro-850       Recombinant Human Catenin, Beta Interacting Protein 1

CUL1    pro-268       Recombinant Human Cullin-1

CUTA   pro-812       Recombinant Human CutA Divalent Cation Tolerance Homolog

CUTC   pro-911       Recombinant Human cutC Copper Transporter Homolog

CYB5A pro-910       Recombinant Human Cytochrome B5 Type A

CYB5R3     pro-1026     Recombinant Human Cytochrome B5 Reductase 3

Cyclosporin-A   pro-408       Cyclosporin-A

CYGB   pro-842       Recombinant Human Cytoglobin

Cys-Protein-G His   pro-1238     Recombinant Cys-Protein G His Tag

CYTH2 pro-1248     Recombinant Human Cytohesin 2

D4GDI  pro-296       Recombinant Human D4-GDI

DBI       pro-832       Recombinant Human Diazepam Binding Inhibitor

DBNDD1    pro-1162     Recombinant Human Dysbindin (Dystrobrevin Binding Protein 1) Domain Containing 1

DBNDD2    pro-1167     Recombinant Human Dysbindin (Dystrobrevin Binding Protein 1) Domain Containing 2

DCAF7 pro-909       Recombinant Human DDB1 and CUL4 Associated Factor 7

dCASQ2     pro-410       Dog Calsequestrin-2

DCUN1D1  pro-078       Recombinant Human DCN1 Defective in Cullin Neddylation 1 Domain Containing 1

DCUN1D2  pro-899       Recombinant Human DCN1 Defective in Cullin Neddylation 1 Domain Containing 2

DDIT3   pro-638       Recombinant Human DNA Damage Inducible Transcript 3

DDIT4   pro-094       Recombinant Human DNA Damage Inducible Transcript 4

DEDD  pro-1349     Recombinant Human Death Effector Domain Containing

DENR  pro-926       Recombinant Human Density-Regulated Protein

Desmin       pro-520       Recombinant Human Desmin

DFFA   pro-718       Recombinant Human DNA Fragmentation Factor Subunit Alpha

DGCR6       pro-1372     Recombinant Human DiGeorge Syndrome Critical Region Gene 6

DIRAS1      pro-256       Recombinant Human DIRAS family, GTP-binding RAS-like 1

DKK1   pro-673       Recombinant Human Dickkopf-Related Protein 1

DKK1 HEK pro-815       Recombinant Human Dickkopf-Related Protein 1 HEK

DKK2   pro-1205     Recombinant Human Dickkopf-Related Protein 2

DKK3   pro-1175     Recombinant Human Dickkopf-Related Protein 3

DNAL1 pro-1357     Recombinant Human Dynein Axonemal Light Chain 1

DNAL4 pro-227       Recombinant Human Dynein Axonemal Light Chain 4

DPPA3 pro-1291     Recombinant Human Developmental Pluripotency Associated 3

DR1      pro-542       Recombinant Human Down-Regulator of Transcription 1

DRG1   pro-885       Recombinant Human Developmentally Regulated GTP Binding Protein 1

DSTN   pro-1137     Recombinant Human Destrin

DTNBP1     pro-675       Recombinant Human Dystrobrevin-Binding Protein 1 Isoform C

DYNLL1      pro-262       Recombinant Human Dynein Light Chain LC8 Type-1

DYNLL2      pro-235       Recombinant Human Dynein Light Chain LC8 Type-2

DYNLRB1  pro-489      Recombinant Human Dynein Light Chain Roadblock-Type 1

DYNLRB2  pro-174       Recombinant Human Dynein Light Chain Roadblock-Type 2

DYNLT1      pro-757       Recombinant Human Dynein, Light Chain, Tctex-Type 1

DYNLT3      pro-1197     Recombinant Human Dynein, Light Chain, Tctex-Type 3

EBAG9 pro-343       Recombinant Human Estrogen Receptor Binding Site Associated Antigen 9

ECSIT        pro-1241     Recombinant Human ECSIT homolog 

EDF1    pro-494       Recombinant Human Endothelial Differentiation-Related Factor 1

EEF1B2      pro-167       Recombinant Human Eukaryotic Translation Elongation Factor 1 Beta 2

EEF1D pro-170       Recombinant Human Eukaryotic Translation Elongation Factor 1 Delta

EEF1E1      pro-199       Recombinant Human Eukaryotic Translation Elongation Factor 1 Epsilon 1

EFNA1 pro-971       Recombinant Human Ephrin A1

EFNA4 pro-498       Recombinant Human Ephrin A4

EFNB1 pro-918       Recombinant Human Ephrin- B1

EFNB2 pro-937       Recombinant Human Ephrin- B2

EFNB3 pro-1169     Recombinant Human Ephrin- B3

EGLN3 pro-1143     Recombinant Human Egl Nine Homolog 3

EIF1      pro-773       Recombinant Human Eukaryotic Translation Initiation Factor 1

EIF1AX       pro-253       Recombinant Human Eukaryotic Translation Initiation Factor 1A X-linked

EIF1AY       pro-098       Recombinant Human Eukaryotic Translation Initiation Factor 1A Y-linked

EIF1B   pro-175       Recombinant Human Eukaryotic Translation Initiation Factor 1B

EIF2B1 pro-209       Recombinant Human Eukaryotic Translation Initiation Factor 2B Subunit 1 Alpha

EIF2S1 pro-845       Recombinant Human Eukaryotic Translation Initiation Factor 2 Subunit 1 Alpha

EIF3J    pro-970       Recombinant Human Eukaryotic Translation Initiation Factor 3J

EIF3K   pro-179       Recombinant Human Eukaryotic Translation Initiation Factor 3K

EIF4A3 pro-1007     Recombinant Human Eukaryotic Translation Initiation Factor 4A3

EIF4E   pro-530       Recombinant Human Eukaryotic Translation Initiation Factor 4E

EIF4EBP1  pro-532       Recombinant Human Eukaryotic Translation Initiation Factor 4E-Binding Protein 1

EIF4EBP2  pro-176       Recombinant Human Eukaryotic Translation Initiation Factor 4E-Binding Protein 2

EIF4H   pro-1114     Recombinant Human Eukaryotic Translation Initiation Factor 4H

EIF5A   pro-674       Recombinant Human Eukaryotic Translation Initiation Factor 5A

EIF5A2 pro-846       Recombinant Human Eukaryotic Translation Initiation Factor 5A2

Eledoisin    pro-281       Eledoisin

EMCN  pro-1156     Recombinant Human Endomucin

EMG1   pro-1122     Recombinant Human EMG1 Nucleolar Protein

Endostatin  pro-248       Recombinant Human Endostatin

Enfuvirtide pro-376       Enfuvirtide T-20

ENSA   pro-772       Recombinant Human Endosulfine Alpha

EPCAM       pro-1322     Recombinant Human Epithelial Cell Adhesion Molecule

Eptifibatide pro-358       Human Eptifibatide

ER-a     pro-499       Recombinant Human Estrogen Receptor Alpha

ERCC1       pro-1106     Recombinant Human Excision Repair Cross-Complementing 1

ERCC1, GST    pro-496       Recombinant Human Excision Repair Cross-Complementing 1, GST Tag

ERH     pro-121       Recombinant Human Enhancer of Rudimentary

ERLIN2       pro-1266     Recombinant Human ER Lipid Raft Associated 2

ERP27 pro-046       Recombinant Human Endoplasmic Reticulum Protein 27

ERP44 pro-547       Recombinant Human Endoplasmic Reticulum Protein 44

ESAT6 pro-291       Recombinant Early Secretory Target Mycobacterium Tuberculosis

E-Selectin  pro-380       Recombinant Human E-Selectin

ESM1   pro-1328     Recombinant Human Endothelial Cell-Specific Molecule 1

ETFB    pro-220       Recombinant Human Electron-Transfer-Flavoprotein Beta Polypeptide

ETHE1 pro-1027     Recombinant Human Ethylmalonic Encephalopathy 1

ETS1    pro-501       Recombinant Human C-ets-1 Protein

EXOSC10  pro-444       Recombinant Human Exosome Component 10

EXOSC5     pro-1059     Recombinant Human Exosome Component 5

EXOSC9     pro-126       Recombinant Human Exosome Component 9

EYA2    pro-1071     Recombinant Human Eyes Absent Homolog 2

F11R    pro-1112     Recombinant Human F11 Receptor

F3  pro-312       Recombinant Human Coagulation Factor III

F7  pro-331       Recombinant Human Coagulation Factor VIIa

F8  pro-317       Human Coagulation Factor VIII

F8  pro-318       Recombinant Human Coagulation Factor VIII

F9  pro-353       Human Coagulation Factor IX

FABP1 pro-588       Recombinant Human Fatty Acid Binding Protein-1

mFABP1     pro-1121     Recombinant Mouse Fatty Acid Binding Protein-1

FABP12      pro-738       Recombinant Human Fatty Acid Binding Protein-12

FABP2 pro-669       Recombinant Human Fatty Acid Binding Protein-2

FABP3 pro-340       Recombinant Human Fatty Acid Binding Protein-3

FABP3 His pro-668       Recombinant Human Fatty Acid Binding Protein-3, His Tag

FABP4 pro-416       Recombinant Human Fatty Acid Binding Protein-4

FABP4 His pro-566       Recombinant Human Fatty Acid Binding Protein-4, His Tag

FABP5 pro-417       Recombinant Human Fatty Acid Binding Protein-5

FABP5 His pro-666       Recombinant Human Fatty Acid Binding Protein-5, His Tag

FABP6 pro-649       Recombinant Human Fatty Acid Binding Protein-6

FABP6 His pro-667       Recombinant Human Fatty Acid Binding Protein-6, His Tag

FABP7 pro-628       Recombinant Human Fatty Acid Binding Protein-7

FABP7 His pro-661       Recombinant Human Fatty Acid Binding Protein-7, His Tag

FABP9 pro-1088     Recombinant Human Fatty Acid Binding Protein-9

FADD   pro-733       Recombinant Human Fas-Associated Death Domain

FAM3B pro-139       Recombinant Human Family with Sequence Similarity 3, Member B

FAM3C       pro-952       Recombinant Human Family with Sequence Similarity 3, Member C

FAM49B     pro-1411     Recombinant Human Family with Sequence Similarity 49, Member B

FCGR1A     pro-1228     Recombinant Human CD64

FCGR2A     pro-029       Recombinant Human CD32a

FCGR2B     pro-1295     Recombinant Human CD32

FCGR3A     pro-1150     Recombinant Human CD16a

FDCSP       pro-1339     Recombinant Human Follicular Dendritic Cell Secreted Protein

FDX1    pro-713       Recombinant Human Ferredoxin-1

Ferritin pro-564       Human Liver Ferritin

Ferritin Heavy   pro-658       Recombinant Human Ferritin Heavy Chain

Ferritin Light     pro-650       Recombinant Human Ferritin Light Chain

Fetuin-A     pro-418       Human Alpha-2-HS-Glycoprotein

FHIT     pro-828       Recombinant Human Fragile Histidine Triad

FHIT, GST  pro-297       Recombinant Human Fragile Histidine Triad, GST Tag

Fibronectin pro-448       Human Fibronectin

Filamin pro-521       Filamin

FIMC    pro-120       Recombinant E.Coli Chaperone Protein fimC

FIS1      pro-829       Recombinant Human Fission-1

Flagellin     pro-1240     Recombinant Flagellin

FOPNL pro-1195     Recombinant Human FGFR1OP N-terminal like

FOS-B  pro-505       Recombinant Human FOS-B

Frataxin      pro-761       Recombinant Human Frataxin

FRZB   pro-1345     Recombinant Human Frizzled-Related Protein

FSCN1 pro-527       Recombinant Human Fascin

FTSJ2  pro-1207     Recombinant Human FtsJ RNA Methyltransferase Homolog 2

FUBP1 pro-1132     Recombinant Human Far Upstream Element Binding Protein

FUR      pro-622       Recombinant E.Coli Ferric Uptake Regulator

FXYD5 pro-1366     Recombinant Human FXYD5

Fyn-p59      pro-506       Recombinant Human Fyn-p59

FZD1    pro-816       Recombinant Human Frizzled-1

GABARAP pro-775       Recombinant Human  GABA(A) Receptor-Associated Protein

GABARAPL1    pro-048       Recombinant Human GABA(A) Receptor-Associated Protein Like 1

GABARAPL2    pro-079       Recombinant Human GABA(A) Receptor-Associated Protein Like 2

GADD45A  pro-783       Recombinant Human Growth Arrest and DNA-Damage-Inducible Alpha

GADD45B  pro-563       Recombinant Human Growth Arrest and DNA-Damage-Inducible Beta

GADD45G  pro-570       Recombinant Human Growth Arrest and DNA-Damage-Inducible Gamma

GADD45GIP1   pro-972       Recombinant Human Growth Arrest and DNA-Damage-Inducible Gamma Interacting Protein 1

GAGA-POZ       pro-435       Recombinant Drosophila melanogaster GAGA-POZ

GAP43 pro-1126     Recombinant Human Growth Associated Protein 43

GAS7   pro-680       Recombinant Human Growth Arrest-Specific 7, Isoform b

GCA     pro-080       Recombinant Human Grancalcin

GCSAM      pro-1282     Recombinant Human Germinal Center-Associated, Signaling and Motility

GCSH  pro-973       Recombinant Human Glycine Cleavage System Protein H

GCV     syn-001       Ganciclovir

Gelatin pro-481       Recombinant Human Gelatin

GEMIN6      pro-1394     Recombinant Human Gem-Associated Protein 6

GFER   pro-1326     Recombinant Human Growth Factor, Augmenter of Liver Regeneration

GFP      pro-522       Glial Filament Protein

GINS4  pro-1270     Recombinant Human GINS Complex Subunit 4

GIPC1  pro-855       Recombinant Human GIPC PDZ Domain Member 1

GIPC2  pro-1035     Recombinant Human GIPC PDZ Domain Member 2

GKN1   pro-1206     Recombinant Human Gastrokine 1

GLC8    pro-540       Recombinant Yeast GLC8

Gliadin pro-114       Recombinant Wheat Gliadin

GLIPR2       pro-550       Recombinant Human GLI Pathogenesis-Related 2

GLOD4 pro-894       Recombinant Human Glyoxalase Domain Containing 4

GLTP    pro-1313     Recombinant Human Glycolipid Transfer Protein

GMNN  pro-579       Recombinant Human Geminin

GNAI1  pro-940       Recombinant Human Guanine Nucleotide Binding Protein Alpha Inhibiting Activity 1

GNAI2  pro-1310     Recombinant Human Guanine Nucleotide Binding Protein-G Alpha Inhibiting Activity Polypeptide 2

GNAI3  pro-1074     Recombinant Human Guanine Nucleotide Binding Protein Alpha Inhibiting Activity 3

GNAZ   pro-1225     Recombinant Human Guanine Nucleotide Binding Protein Alpha Z Polypeptide

GNB2L1      pro-1023     Recombinant Human Guanine Nucleotide Binding Protein beta polypeptide 2-like 1

GNLY   pro-852       Recombinant Human Granulysin

GOPC  pro-793       Recombinant Human Golgi-Associated PDZ and Coiled-Coil Motif Containing

GOSR2       pro-1399     Recombinant Human Golgi SNAP Receptor Complex Member 2

GP2      pro-115       Recombinant Human Glycoprotein-2

GP9      pro-055       Recombinant Human Glycoprotein-9

GPN1   pro-1140     Recombinant Human GPN-loop GTPase 1

GRAP2       pro-081       Recombinant Human GRB2-Related Adaptor Protein 2

GRB2   pro-678       Recombinant Human Growth Factor Receptor-Bound Protein 2

GREM1       pro-1359     Recombinant Human GREM1

GRPEL1     pro-263       Recombinant Human GrpE-Like 1

GTF2B pro-762       Recombinant Human General Transcription Factor IIB

GTF2E2      pro-1107     Recombinant Human General Transcription Factor IIE, Polypeptide 2

GTF2F2      pro-1093     Recombinant Human General Transcription Factor IIF, Polypeptide 2

GULP1 pro-1398     Recombinant Human GULP1

HAND1       pro-1231     Recombinant Human Heart and Neural Crest Derivatives Expressed 1

Haptoglobin      pro-567       Recombinant Human Haptoglobin

Haptoglobin      pro-558       Human Haptoglobin

HAUS1       pro-1077     Recombinant Human HAUS Augmin-Like Complex, Subunit 1

HAX1   pro-1367     Recombinant Human HCLS1 Associated Protein X-1

HbA1c  pro-299       Human Hemoglobin A1c

HBA2   pro-1183     Recombinant Human Hemoglobin, Alpha 2

HBG2   pro-021       Recombinant Human Hemoglobin Gamma G

HBZ      pro-803       Recombinant Human Hemoglobin-Zeta

HDL      pro-559       Human High Density Lipoprotein

HEBP1 pro-1316     Recombinant Human Heme Binding Protein 1

Hemopexin       pro-560       Human Hemopexin

HES7   pro-1306     Recombinant Human Hairy and Enhancer of Split 7

HEXIM1      pro-789       Recombinant Human Hexamethylene Bis-Acetamide Inducible 1

HFE      pro-1332     Recombinant Human Hemochromatosis

HIF1A   pro-477       Recombinant Human Hypoxia-Inducible Factor-1 Alpha

HIF1A (85 a.a.) pro-258       Recombinant Human Hypoxia-Inducible Factor-1 Alpha (85 a.a.)

HIF1A His   pro-415       Recombinant Human Hypoxia-Inducible Factor-1 Alpha His Tag

HIF1AN       pro-662       Recombinant Human Hypoxia-Inducible Factor-1 Alpha Inhibitor

HINT1   pro-702       Recombinant Human Histidine Triad Nucleotide Binding Protein 1

Hirudin pro-362       Recombinant Hirudin

HLF      pro-904       Recombinant Human Hepatic Leukemia Factor

HMGA1       pro-887       Recombinant Human High Mobility Group AT-Hook 1

HMGB1       pro-581       Recombinant Human High-Mobility Group Box 1

HMGB1  Hi-5  pro-610       Recombinant Human High-Mobility Group Box 1 Hi-5 Insect Cells

HMGB2       pro-888       Recombinant Human High-Mobility Group Box 2

HMGN1       pro-821       Recombinant Human High-Mobility Group Nucleosome Binding Domain 1

HN1L    pro-027       Recombinant Human Hematological and Neurological Expressed 1-Like

HNRNPA1 pro-1038     Recombinant Human Heterogeneous Nuclear Ribonucleoprotein A1

HNRNPC   pro-177       Recombinant Human Heterogeneous Nuclear Ribonucleoprotein C

Holo Transferrin      pro-315       Human Holo Transferrin

HOMER1    pro-695       Recombinant Human Homer Homolog-1

HOMER2    pro-1072     Recombinant Human Homer Homolog-2

HOMER3    pro-1108     Recombinant Human Homer Homolog-3

HOPX   pro-1158     Recombinant Human HOP homeobox

HPCAL1     pro-254       Recombinant Human Hippocalcin-Like 1

HPG1   pro-423       Recombinant Human Prostate Specific Gene-1

HRAS   pro-822       Recombinant Human V-Ha-ras Harvey Rat Sarcoma Viral Oncogene Homolog

HRSP12     pro-052       Recombinant Human Heat-Responsive Protein 12

HSA      pro-354       Human Serum Albumin

HSCB   pro-1142     Recombinant Human HscB Iron-Sulfur Cluster Co-Chaperone

HSD17B10 pro-823       Recombinant Human Hydroxysteroid (17-beta) Dehydrogenase 10

HUS1   pro-039       Recombinant Human HUS1 Checkpoint Homolog

ICAM-1 pro-383       Recombinant Human Intercellular Adhesion Molecule-1

ICT1      pro-1303     Recombinant Human Immature Colon Carcinoma Transcript 1

ID2 pro-1383     Recombinant Human Inhibitor of DNA Binding 2

IFT20    pro-1222     Recombinant Human Intraflagellar Transport 20 Homolog

IGLL1   pro-1390     Recombinant Human Immunoglobulin Lambda-Like Polypeptide 1

IGJ pro-1416     Recombinant Human Immunoglobulin J

IMP3     pro-015       Recombinant Human IMP3

IMPAD1      pro-1346     Recombinant Human Inositol Monophosphatase Domain Containing 1

mIgG    pro-1087     Recombinant Mouse Immunoglobulin Heavy Chain Constant Region Gamma 2a          

mIgG His     pro-1086    Recombinant Mouse Immunoglobulin Heavy Chain Constant Region Gamma 2a, His Tag

Intein    pro-958       Recombinant Bacillus Circulans Intein

Internalin    pro-031       Recombinant Listeria Monocytogenes Internalin 

Intrinsic Factor  pro-375       Recombinant Human Intrinsic Factor

Involucrin   pro-512       Recombinant Human Involucrin

IPP-POZ     pro-436       Recombinant Human IPP-POZ

IRGM    pro-1302     Recombinant Human Immunity-Related GTPase Family, M

ISCU    pro-072       Recombinant Human Iron-sulfur Cluster Scaffold Homolog

ISG15   pro-611       Recombinant Human Interferon Stimulated Gene 15

ITGB1BP3  pro-1177     Recombinant Human Integrin Beta 1 Binding Protein 3

JAM2    pro-1336     Recombinant Human Junctional Adhesion Molecule 2

JAM3    pro-1223     Recombinant Human Junctional Adhesion Molecule 3

JOSD1 pro-1251     Recombinant Human Josephin Domain Containing 1

k9Cystatin-C     pro-138       Recombinant Canine Cystatin-C

KAAG1 pro-192       Recombinant Human Kidney Associated Antigen 1

KCNIP3      pro-009       Recombinant Human Kv Channel Interacting Protein 3

KCTD5 pro-1276     Recombinant Human Potassium Channel Tetramerisation Domain Containing 5

KCTD11      pro-1376     Recombinant Human Potassium Channel Tetramerisation Domain Containing 11

KCTD15      pro-1002     Recombinant Human Potassium Channel Tetramerisation Domain Containing 15

KIN       pro-1275     Recombinant Human KIN

KIR2DL1     pro-428       Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Long Cytoplasmic Tail 1

KIR2DL3     pro-429       Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Long Cytoplasmic Tail 3

KIR2DS4    pro-430       Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Short Cytoplasmic Tail 4

KIR3DL1     pro-427       Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 3 Domains Long Cytoplasmic Tail 1

KISS1   pro-419       Recombinant Human KISS-1 Metastasis-Suppressor

KLF4    pro-891       Recombinant Human Kruppel-Like Factor 4

KLRB1 pro-1189     Recombinant Human Killer Cell Lectin-Like Receptor Subfamily B, Member 1

KLRC2 pro-1190     Recombinant Human Killer Cell Lectin-Like Receptor Subfamily C, Member 2

KLRC3 pro-1230     Recombinant Human Killer Cell Lectin-Like Receptor Subfamily C, Member 3

KLRG1 pro-1344     Recombinant Human Killer Cell lectin-like Receptor Subfamily G, Member 1

KLRK1 pro-1290     Recombinant Human Killer Cell lectin-Like Receptor Subfamily K, Member 1

KPNA2 pro-1032     Recombinant Human karyopherin Alpha 2

KPNB1 pro-1001     Recombinant Human karyopherin Beta 1

KRAS   pro-854       Recombinant Human Kirsten Rat Sarcoma Viral Oncogene

KRT14  pro-348       Recombinant Human Cytokeratin 14

KRT14 His  pro-941       Recombinant Human Cytokeratin 14 His Tag

KRT18  pro-349       Recombinant Human Cytokeratin 18

KRT18 His  pro-484       Recombinant Human Cytokeratin 18 His Tag

KRT19  pro-350       Recombinant Human Cytokeratin 19

KRT19 His  pro-1347     Recombinant Human Cytokeratin 19 His Tag

KRT20  pro-351       Recombinant Human Cytokeratin 20

KRT20 His  pro-1358     Recombinant Human Cytokeratin 20 His Tag

KRT8    pro-347       Recombinant Human Cytokeratin 8

KRT8 GST  pro-298       Recombinant Human Cytokeratin 8 GST-Tag

Ku P70/P80      pro-397       Recombinant Human Ku P70/P80

LA/SS-B      pro-327       Recombinant Human LA / SS-B

LAIR1   pro-431       Recombinant Human Leukocyte-Associated Ig-Like Receptor 1

LAIR2   pro-1081     Recombinant Human Leukocyte-Associated Ig-Like Receptor 2

Lamin-A      pro-690       Recombinant Human Lamin-A

LAMP2 pro-130       Recombinant Human Lysosomal-Associated Membrane Protein 2

LASP1 pro-1031     Recombinant Human LIM and SH3 Protein 1

LAT       pro-948       Recombinant Human Linker for Activation of T Cells

LBP      pro-538       Recombinant Human Lipopolysaccarid Binding Protein

mLBP   pro-539       Recombinant Mouse Lipopolysaccarid Binding Protein

LDL       pro-562       Low Density Lipoprotein

LDLRAP1   pro-1033     Recombinant Human Low Density Lipoprotein Receptor Adaptor Protein 1

LDOC1L     pro-1153     Recombinant Human Leucine Zipper, Down-Regulated in Cancer 1-Like

LEFTY1      pro-962       Recombinant Human Left-Right Determination Factor 1

LGALS10    pro-744       Recombinant Human Charcot-Leyden Crystal Protein

LGALSL      pro-1374     Recombinant Human Lectin Galactoside-Binding-Like

LIN28A pro-743       Recombinant Human LIN28

LIN28B pro-1249     Recombinant Human LIN28B

LIN7A   pro-1252     Recombinant Human LIN7A

LIN7B   pro-1298     Recombinant Human LIN7B

LIN7C   pro-1305     Recombinant Human LIN7C

LITAF   pro-1350     Recombinant Human Lipopolysaccharide-Induced TNF Factor

LLC       pro-561       Human Lambda Light Chain

LLO       pro-320       Recombinant Listeriolysin-O

LLO-pest     pro-373       Recombinant Listeriolysin-O PEST-free

LRG1    pro-141       Human Leucine-Rich Alpha-2-Glycoprotein 1

LRPAP1     pro-1029     pro-151

L-Selectin   pro-381       Recombinant Human L-Selectin

LSM1    pro-259       Recombinant Human LSM1 Homolog, U6 Small Nuclear RNA Associated

LSM12 pro-1329     Recombinant Human LSM12 Homolog, U6 Small Nuclear RNA Associated

LSM2    pro-1069     Recombinant Human LSM2 Homolog, U6 Small Nuclear RNA Associated

LSM3    pro-1060     Recombinant Human LSM3 Homolog, U6 Small Nuclear RNA Associated

LSM4    pro-065       Recombinant Human LSM4 Homolog, U6 Small Nuclear RNA Associated

LTF Holo     pro-592       Recombinant Human Lactoferrin Holo

LYG2    pro-1245     Recombinant Human Lysozyme G-Like 2

LYN      pro-136       Recombinant Human v-yes-1 Yamaguchi Sarcoma Viral Related Oncogene

M.Pneumoniae       pro-795       Recombinant Mycoplasma Pneumoniae P1-N2

M.Pneumoniae       pro-801       Recombinant Mycoplasma Pneumoniae P1-C

MAD2L1     pro-934       Recombinant Human MAD2 Mitotic Arrest Deficient-Like 1

MAD2L1BP       pro-1052     Recombinant Human MAD2L1 Binding Protein

MAF1   pro-921       Recombinant Human MAF1

MAFG   pro-968       Recombinant Human V-maf Musculoaponeurotic Fibrosarcoma Oncogene G

MAFK   pro-025       Recombinant Human V-maf Musculoaponeurotic Fibrosarcoma Oncogene K

MAGEA1    pro-311       Recombinant Human Melanoma Antigen Family A, 1

MAGEA3    pro-502       Recombinant Human Melanoma Antigen Family A, 3

MAGEA4    pro-843       Recombinant Human Melanoma Antigen Family A, 4

MAGEA5    pro-1070     Recombinant Human Melanoma Antigen Family A, 5

MAGEA6    pro-1113     Recombinant Human Melanoma Antigen Family A, 6

MAGOH      pro-810       Recombinant Human Mago-Nashi Homolog

MAP1LC3A       pro-495       Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 Alpha

MAP1LC3B       pro-076       Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 Beta

MAP1LC3B2     pro-215       Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 Beta 2

MAPKSP1  pro-034       Recombinant Human MAPK Scaffold Protein 1

MAPRE1    pro-058       Recombinant Human Microtubule-Associated Protein, RP/EB Family, Member 1

MAPRE2    pro-932       Recombinant Human Microtubule-Associated Protein, RP/EB Family, Member 2

MAPRE3    pro-264       Recombinant Human Microtubule-Associated Protein, RP/EB Family, Member 3

MAPT   pro-295       Recombinant Human Microtubule-Associated Protein Tau

MAPT 381a.a.   pro-042       Recombinant Human Microtubule-Associated Protein Tau 381 a.a.

MAPT 383a.a.   pro-012       Recombinant Human Microtubule-Associated Protein Tau 383 a.a.

MAPT 412a.a.   pro-210       Recombinant Human Microtubule-Associated Protein Tau 412 a.a.

MAVS   pro-1351     Recombinant Human Mitochondrial Antiviral Signaling Protein

MAX     pro-811       Recombinant Human MYC Associated Factor X

MBD3   pro-1243     Recombinant Human Methyl-CpG Binding Domain Protein 3

MBL2    pro-1285     Recombinant Human Mannose-Binding Lectin 2

MBP     pro-616       Recombinant E.Coli Maltose Binding Protein

MCFD2       pro-769       Recombinant Human Multiple Coagulation Factor Deficiency 2

MCL1   pro-1202     Recombinant Human Myeloid Cell Leukemia Sequence 1

MCTS1 pro-1387     Recombinant Human Malignant T-Cell-Amplified Sequence 1

MECP2       pro-212       Recombinant Human Methyl CpG Binding Protein 2

MED20 pro-1204     Recombinant Human Mediator Complex Subunit 20

MED4   pro-785       Recombinant Human Mediator Complex Subunit 4

MED7   pro-1319     Recombinant Human Mediator Complex Subunit 7

Melanoma  pro-509       Recombinant Human Melanoma (gp100)

MEMO1       pro-1148     Recombinant Human Mediator of Cell Motility 1

MESDC2    pro-122       Recombinant Human Mesoderm Development Candidate 2

MET      pro-207       Recombinant Human Met Proto-Oncogene

MET, GST   pro-497       Recombinant Human Met Proto-Oncogene, GST Tag

MFAP2 pro-1265     Recombinant Human Microfibrillar-associated Protein 2

MFAP4 pro-1210     Recombinant Human Microfibrillar-associated Protein 4

MGP     pro-922       Recombinant Human Matrix Gla Protein

MICA    pro-367       Recombinant Human MHC class I chain-related gene A

MICB    pro-368       Recombinant Human MHC class I chain-related gene B

MIS12   pro-022       Recombinant Human MIS12

MLF1    pro-100       Recombinant Human Myeloid Leukemia Factor 1

MMACHC   pro-1119     Recombinant Human Methylmalonic Aciduria cblC type, with Homocystinuria

MNDA  pro-763       Recombinant Human Myeloid Cell Nuclear Differentiation Antigen

MOBKL1B  pro-068       Recombinant Human MOB1, Mps One Binder Kinase Activator-Like 1B

MOBLK3     pro-049       Recombinant Human MOB1, Mps One Binder Kinase Activator-Like 3

MOCS2       pro-1281     Recombinant Human Molybdenum Cofactor Synthesis 2

MOG     pro-371       Myelin Oligodendrocyte Glycoprotein

MOG     pro-466       Recombinant Human Myelin Oligodendrocyte Glycoprotein

MORF4L1   pro-1078     Recombinant Human Mortality Factor 4 Like 1

MORF4L2   pro-475       Recombinant Human Mortality Factor 4 Like 2

MRAS  pro-1008     Recombinant Human Muscle RAS Oncogene Homolog

MRM1  pro-1416     Recombinant Human Mitochondrial RRNA Methyltransferase 1

MRRF  pro-1299     Recombinant Human Mitochondrial Ribosome Recycling Factor

MRTO4       pro-1233     Recombinant Human mRNA Turnover 4

MRPL28     pro-1279     Recombinant Human Mitochondrial Ribosomal Protein L28

MRPL13     pro-1404     Recombinant Human Mitochondrial Ribosomal Protein L13

MSH6   pro-745      Recombinant Human MutS Homolog 6

MXD3   pro-1356     Recombinant Human MAX Dimerization Protein 3

MUTED       pro-1155     Recombinant Human MUTED

MYC     pro-087       Recombinant Human V-Myc Myelocytomatosis Viral Oncogene

MYCBP       pro-942       Recombinant Human C-Myc Binding Protein

MYD88 pro-1377     Recombinant Human Myeloid Differentiation Primary Response 88

MYL1    pro-365       Recombinant Human Myosin Light Chain 1

MYL12A      pro-902       Recombinant Human Myosin Light Chain 12A

MYL12B      pro-1124     Recombinant Human Myosin Light Chain 12B

MYL2    pro-524       Recombinant Human Myosin Light Chain 2

MYL4    pro-992       Recombinant Human Myosin Light Chain 4

MYL5    pro-916       Recombinant Human Myosin Light Chain 5

MYL5 (1-173 a.a.)   pro-943       Recombinant Human Myosin Light Chain 5 (1-173 a.a.)

MYL6    pro-171       Recombinant Human Myosin Light Chain 6

MYL6B pro-964       Recombinant Human Myosin Light Chain 6B

MYL7    pro-1109     Recombinant Human Myosin Light Chain 7

MYL9    pro-107       Recombinant Human Myosin Light Chain 9

MYLPF pro-243       Recombinant Human Myosin Light chain, Phosphorylatable, Fast Skeletal Muscle

Myoglobin  pro-336       Recombinant Human Myoglobin

Myoglobin  pro-565       Human Myoglobin

Myoglobin heme free    pro-374       Recombinant Human Myoglobin Heme free

Myoglobin His  pro-071       Recombinant Human Myoglobin, His Tag

NACA   pro-974       Recombinant Human Nascent Polypeptide-Associated Complex Alpha

NANOG      pro-896       Recombinant Human Nanog

NANOG, His     pro-881       Recombinant Human Nanog, His Tag

NANOG-TAT     pro-090       Recombinant Human Nanog-TAT

NAP1L1      pro-985       Recombinant Human Nucleosome Assembly Protein 1-Like 1

NAPA   pro-250       Recombinant Human N-Ethylmaleimide-Sensitive Factor Attachment Protein, Alpha

NAPG   pro-944       Rcombinant Human N-ethylmaleimide-Sensitive Factor Attachment Protein, Gamma

NBL1    pro-1365     Recombinant Human Neuroblastoma 1

NCALD       pro-093       Recombinant Human Neurocalcin Delta

NCBP2       pro-265       Recombinant Human Nuclear Cap Binding Protein Subunit 2

NCEH1       pro-1393     Recombinant Human Neutral Cholesterol Ester Hydrolase 1

NCF1   pro-488       Recombinant Human Neutrophil Cytosolic Factor 1

NCF4   pro-1258     Recombinant Human Neutrophil Cytosolic Factor 4

NCK1   pro-839       Recombinant Human NCK Adaptor Protein 1

NCS1   pro-802       Recombinant Human Neuronal Calcium Sensor 1

NDE1   pro-204       Recombinant Human nudE Nuclear Distribution Gene E Homolog 1

NDRG1       pro-724       Recombinant Human N-Myc Downstream Regulated 1

NDRG2       pro-1198     Recombinant Human N-Myc Downstream Regulated 2

NECAP2     pro-180       Recombinant Human NECAP Endocytosis Associated 2

NFKBIA      pro-960       Recombinant Human NF-kappa-B Inhibitor Alpha

NFKBIB      pro-1046     Recombinant Human NF-kappa-B Inhibitor Beta

NHEJ1 pro-1193     Recombinant Human Nonhomologous End-Joining Factor 1

NHP2   pro-067       Recombinant Human NHP2 Ribonucleoprotein Homolog

NHP2L1      pro-038       Recombinant Human NHP2 Non-Histone Chromosome Protein 2-Like

NIP7     pro-780       Recombinant Human Nuclear Import 7 Homolog

NKIRAS1    pro-1039     Recombinant Human NFKB Inhibitor Interacting Ras-Like 1

NKIRAS2    pro-1091     Recombinant Human NFKB Inhibitor Interacting Ras-Like 2

NKp46        pro-432       Recombinant Human Natural Cytotoxicity Receptor NKp46

NKX3-1       pro-1341     Recombinant Human NK3 Homeobox 1

NME1   pro-715       Recombinant Human Non-Metastatic Cells 1

NME3   pro-082       Recombinant Human Non-Metastatic Cells 3

NME4   pro-219       Recombinant Human Non-Metastatic Cells 4

NMI       pro-070       Recombinant Human N-Myc Interactor

NMM     pro-366       Recombinant Human Non-Muscle Myosin-II Regulatory Light Chain

NMRAL1     pro-1131     Recombinant Human NmrA-Like Family Domain Containing 1

NOL3    pro-1178     Recombinant Human Nucleolar Protein 3

6 pro-1340     Recombinant Human 6

NPM1   pro-1120     Recombinant Human Nucleophosmin

NPM2   pro-1182     Recombinant Human Nucleophosmin 2

NR1H2 pro-869       Recombinant Human Nuclear Receptor Subfamily 1 Group H, Member 2

NRAS   pro-794       Recombinant Human Neuroblastoma RAS Viral Oncogene Homolog

NRIP3  pro-1384     Recombinant Human Nuclear Receptor-Interacting Protein 3

NTAL    pro-827       Recombinant Human Non-T-cell Activation Linker

NTS      pro-1311     Recombinant Human Neurotensin

NUCB2       pro-492       Recombinant Human Nucleobindin-2

NUCB2, His      pro-142       Recombinant Human Nucleobindin-2, His Tag

mNUCB2    pro-605       Recombinant Mouse Nucleobindin-2

NUP210      pro-109       Recombinant Human Nucleopurin 210kDa

NUP62 pro-999       Recombinant Human Nucleopurin 62kDa

NusA    pro-623       Recombinant E.Coli Transcription Termination/Antitermination L Factor

NUTF2 pro-844       Recombinant Human Nuclear Transport Factor 2

NXT1    pro-218       Recombinant Human NTF2-like Export Factor 1

NXT2    pro-1051     Recombinant Human NTF2-like Export Factor 2

NY-ESO-1  pro-531       Recombinant Human New York Esophageal Squamous Cell Carcinoma

OAZ1    pro-1200     Recombinant Human Ornithine Decarboxylase Antizyme 1

OBFC1 pro-028       Recombinant Human Oligonucleotide Binding Fold Containing 1

OCM     pro-143       Recombinant Human Oncomodulin-1

OLR1    pro-923       Recombinant Human Oxidized Low Density Lipoprotein Receptor 1

OMP     pro-1412     Recombinant Human Olfactory Marker Protein

Omp Pylori pro-369       Recombinant Helicobacter Pylori Outer Membrane Protein

OmpA   pro-571       Recombinant Bacterial Outer Membrane Protein-A

ORAOV1    pro-1092     Recombinant Human Oral Cancer Overexpressed 1

ORM1   pro-889       Recombinant Human Orosomucoid 1

Osteocrin    pro-420       Recombinant Human Osteocrin

OTUB1 pro-711       Recombinant Human Ubiquitin Aldehyde Binding 1

OTUB2 pro-214       Recombinant Human Ubiquitin Aldehyde Binding 2

OVCA2       pro-1123     Recombinant Human Ovarian Tumor Suppressor Candidate 2

p53       pro-742       Recombinant Human p53

p53 Mutant pro-301       Recombinant Human p53 Mutant

PA2G4 pro-782       Recombinant Human Proliferation-associated protein 2G4

PAEP   pro-1397     Recombinant Human  Progesterone-Associated Endometrial Protein

PAIP2   pro-748       Recombinant Human Polyadenylate-Binding Protein-Interacting Protein 2

PARD6B     pro-1307     Recombinant Human Par-6 Partitioning Defective 6 Homolog Beta

PARK7 pro-575       Recombinant Human Parkinson Disease Protein 7

PARVA       pro-1257     Recombinant Human Parvin Alpha

PBLD   pro-010       Recombinant Human Phenazine Biosynthesis-Like Protein Domain Containing

pCD163      pro-856       Recombinant Porcine CD163

PCNA   pro-615       Recombinant Human Proliferating Cell Antigen

PCNA GST pro-741       Recombinant Human Proliferating Cell Antigen, GST Tag

PCNA Sf9  pro-303       Recombinant Human Proliferating Cell Antigen, S9

PCNP   pro-906       Recombinant Human PEST proteolytic Signal Containing Nuclear Protein

PDAP1 pro-490       Recombinant Human PDGFA Associated Protein 1

PDCD4       pro-606       Recombinant Human ProgrammedCell Death 4

PDCD5       pro-624       Recombinant Human Programmed Cell Death 5

PDCD6       pro-184       Recombinant Human Programmed Cell Death 6

PDCD6IP   pro-792       Recombinant Human ProgrammedCell Death 6 Interacting Protein

PDCL   pro-1141     Recombinant Human Phosducin-Like

PDCL3 pro-1028     Recombinant Human Phosducin-Like 3

PDPN   pro-626       Recombinant Human Podoplanin

PDRG1       pro-007       Recombinant Human p53 and DNA-Damage Regulated 1

PDZD11     pro-1263     Recombinant Human PDZ Domain Containing 11

PEA15 pro-729       Recombinant Human Phosphoprotein Enriched in Astrocytes 15

PEBP1 pro-722       Recombinant Human Phosphatidylethanolamine Binding Protein 1

PEF1    pro-099       Recombinant Human Penta-EF-Hand Domain Containing 1

PEX      pro-360       Recombinant Human C-terminal hemopexin-like domain of MMP-2 (445-635 a.a.)

PEX19 pro-925       Recombinant Human Peroxisomal Biogenesis Factor 19

PFDN1 pro-277       Recombinant Human Prefoldin Subunit 1

PFDN2 pro-001       Recombinant Human Prefoldin Subunit 2

PFDN4 pro-092       Recombinant Human Prefoldin Subunit 4

PFDN5 pro-901       Recombinant Human Prefoldin Subunit 5

PFDN6 pro-178       Recombinant Human Prefoldin Subunit 6

PFN1    pro-528       Recombinant Human Profilin-1

PFN2    pro-809       Recombinant Human Profilin-2

PFN4    pro-818       Recombinant Human Profilin-4

PGP9.5       pro-576       Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase L1

PGP9.5 GST     pro-304       Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase L1  GST tag

PGR     pro-535       Recombinant Human Progesterone Receptor

PHB      pro-1381     Recombinant Human Prohibitin

PHF11 pro-1268     Recombinant Human PHD Finger Protein 11

PHLDA2     pro-781       Recombinant Human Pleckstrin Homology-Like Domain Family A Member 2

PIM1     pro-1389     Recombinant Human PIM1

PINX1  pro-693       Recombinant Human PIN2-Interacting Protein 1

PIR       pro-1040     Recombinant Human Pirin

PITPNA       pro-044       Recombinant Human Phosphatidylinositol Transfer Protein, Alpha

PITPNB       pro-003       Recombinant Human Phosphatidylinositol Transfer Protein, Beta

PLDN   pro-1068     Recombinant Human Pallidin Homolog

PLSCR1     pro-1271     Recombinant Human Phospholipid Scramblase 1

PMP2   pro-651       Recombinant Human Peripheral Myelin Protein-2

PMP2 His   pro-671       Recombinant Human Peripheral Myelin Protein-2, His Tag

POLR2J      pro-1260     Recombinant Human Polymerase (RNA) III (DNA directed) Polypeptide J

POLR3H     pro-1250     Recombinant Human Polymerase (RNA) III (DNA directed) Polypeptide H 

POMC  pro-236       Recombinant Human Proopiomelanocortin

POP4   pro-1407     Recombinant Human Processing Of Precursor 4

POU2AF1   pro-880       Recombinant Human POU class 2 associating factor 1

POU5F1     pro-088       Recombinant Human POU Class 5 Homeobox 1

POU5F1 PolyR       pro-091       Recombinant Human POU Class 5 Homeobox 1 Polyarginine-Tag

PQBP1 pro-1101     Recombinant Human Polyglutamine Binding Protein 1

Prealbumin       pro-771       Recombinant Human Transthyretin

Prelamin-A pro-689      Recombinant Prelamin-A

PRND  pro-018       Recombinant Human Prion Protein 2 

PRNP   pro-1400     Recombinant Human Prion Protein

PROC  pro-485       Recombinant Human Protein-c

Protein-A/G       pro-646       Recombinant Protein A/G

Protein-G    pro-402       Recombinant Protein G

Protein-G His    pro-1237     Recombinant Protein G His Tag

Prothrombin      pro-439       Human Prothrombin Complex

P-Selectin  pro-382       Recombinant Human P-Selectin

PSMA   pro-740       Recombinant Human Prostate Specific Membrane Antigen

PSMB10     pro-931       Recombinant Human Proteasome Beta Type 10

PSME1       pro-266      Recombinant Human Proteasome Activator Subunit 1

PSME2       pro-975       Recombinant Human Proteasome Activator Subunit 2

PSME3       pro-987       Recombinant Human Proteasome Activator Subunit 3

PSMG2       pro-930       Recombinant Human Proteasome Assembly Chaperone 2

PSMG3       pro-261       Recombinant Human Proteasome Assembly Chaperone 3

PSMG4       pro-989       Recombinant Human Proteasome Assembly Chaperone 4

PSP94 pro-598       Recombinant Human Beta-Microseminoprotein

PTEN   pro-305       Recombinant Human Phosphatase and Tensin Homolog 

PTEN His   pro-712       Recombinant Human Phosphatase and Tensin homolog  His Tag

PTGDS       pro-316       Recombinant Human Beta-Trace

pThrombin  pro-617       Porcine Thrombin

pTrypsin     pro-787       Recombinant Porcine Trypsin

PTTG1  pro-717       Recombinant Human Pituitary Tumor-Transforming Protein 1 

PTX3    pro-694       Recombinant Human Pentraxin-3

PVALB pro-004       Recombinant Human Parvalbumin

RAB10 pro-1361     Recombinant Human RAB10, Member RAS Oncogene Family

RAB11A     pro-826       Recombinant Human RAB11A, Member RAS Oncogene Family

RAB13 pro-882       Recombinant Human RAB13, Member RAS Oncogene Family

RAB14 pro-873       Recombinant Human RAB14, Member RAS Oncogene Family

RAB17 pro-874       Recombinant Human RAB17, Member RAS Oncogene Family

RAB18 pro-976       Recombinant Human RAB18, Member RAS Oncogene Family

RAB1A pro-097       Recombinant Human RAB1A, Member RAS Oncogene Family

RAB1B pro-045       Recombinant Human RAB1B, Member RAS Oncogene Family

RAB21 pro-101       Recombinant Human RAB21, Member RAS Oncogene Family

RAB22A     pro-929       Recombinant Human RAB22, Member RAS Oncogene Family

RAB23 pro-977       Recombinant Human RAB23, Member RAS Oncogene Family

RAB24 pro-951       Recombinant Human RAB24, Member RAS Oncogene Family

RAB27A     pro-825       Recombinant Human RAB27A, Member RAS Oncogene Family

RAB27B     pro-075       Recombinant Human RAB27B, Member RAS Oncogene Family

RAB2A pro-244       Recombinant Human RAB2A, Member RAS Oncogene Family

RAB2B pro-1013     Recombinant Human RAB2B, Member RAS Oncogene Family

RAB31 pro-1090     Recombinant Human RAB31, Member RAS Oncogene Family

RAB32 pro-950       Recombinant Human RAB32, Member RAS Oncogene Family

RAB34 pro-978       Recombinant Human RAB34, Member RAS Oncogene Family

RAB35 pro-935       Recombinant Human RAB35, Member RAS Oncogene Family

RAB3A pro-870       Recombinant Human RAB3A, Member RAS Oncogene Family

RAB3B pro-875       Recombinant Human RAB3B, Member RAS Oncogene Family

RAB3D       pro-247       Recombinant Human RAB3D, Member RAS Oncogene Family

RAB4A pro-871       Recombinant Human RAB4A, Member RAS Oncogene Family

RAB5A pro-590       Recombinant Human RAB5A, Member RAS Oncogene Family

RAB5B pro-056       Recombinant Human RAB5B, Member RAS Oncogene Family

RAB6A pro-047       Recombinant Human RAB6A, Member RAS Oncogene Family

RAB6B pro-103       Recombinant Human RAB6B, Member RAS Oncogene Family

RAB7A pro-077       Recombinant Human RAB7A, Member RAS Oncogene Family

RABIF  pro-300       Recombinant Human RAB Interacting Factor

RAC1   pro-572       Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1

RAC1 His   pro-731       Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1 His Tag

RAC2   pro-619       Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 2

RAC2 (189)       pro-719       Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 2 (1-189)

RAC3   pro-073       Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 3

RAD1   pro-868       Recombinant Human RAD1

RAET1E     pro-1293     Recombinant Human Retinoic Acid Early Transcript 1E

RALA   pro-043      Recombinant Human V-ral Simian Leukemia Viral Oncogene Homolog A

RALB   pro-053       Recombinant Human V-ral Simian Leukemia Viral Oncogene Homolog B

RAMP3       pro-1367     Recombinant Human Receptor Activity-Modifying Protein 3

RAN     pro-841       Recombinant Human RAN, Member RAS Oncogene Family

RANBP1     pro-1064     Recombinant Human RAN Binding Protein 1

RANGRF    pro-1149     Recombinant Human RAN Guanine Nucleotide Release Factor

RAP1A pro-848       Recombinant Human RAP1A, Member RAS Oncogene Family

RAP1B pro-083       Recombinant Human RAP1B, Member RAS Oncogene Family

RAP2B pro-1364     Recombinant Human RAP2B, Member RAS Oncogene Family

RAP2A pro-061       Recombinant Human RAP2A, Member RAS Oncogene Family

RARA   pro-596       Recombinant Retnoid Acid Receptor Alpha

RARRES2  pro-788       Recombinant Human Retinoic Acid Receptor Responder 2

RASSF1A  pro-1288     Recombinant Human Ras association domain-containing protein 1

RASSF3     pro-1378     Recombinant Human Ras Association Domain-Containing Protein 3

RB1      pro-584       Recombinant Human Retinoblastoma Associated Protein

RBBP4 pro-1168     Recombinant Human Retinoblastoma Binding Protein 4

RBBP9 pro-991       Recombinant Human Retinoblastoma Binding Protein 9

RBM8A       pro-186       Recombinant Human RNA Binding Motif Protein 8A

rCALB1       pro-400       Recombinant Rat Calbindin-1

RCAN1       pro-319       Recombinant Human Regulator of Calcineurin 1

RCAN2       pro-990       Recombinant Human Regulator of Calcineurin 2

RCAN3       pro-1284     Recombinant Human Regulator of Calcineurin 3

RCN1   pro-544       Recombinant Human Reticulocalbin 1

RCN2   pro-189       Recombinant Human Reticulocalbin 2

RCN3   pro-1049     Recombinant Human Reticulocalbin 3

RCVRN      pro-441       Recombinant Human Recoverin

RDBP   pro-181       Recombinant Human RD RNA Binding Protein

REG1A       pro-289       Recombinant Human Regenerating Islet-Derived 1 Alpha

REG1B       pro-391       Recombinant Human Regenerating Islet-Derived 1 Beta

REG3A       pro-421       Recombinant Human Regenerating Islet-Derived 3 Alpha

REG4   pro-424       Recombinant Human Regenerating Islet-Derived 4

RERG  pro-106       Recombinant Human RAS-like, Estrogen-Regulated, Growth Inhibitor

rFibronectin      pro-131       Rat Fibronectin

rGFP     pro-687       Recombinant Green Fluorescent Protein

RGN     pro-915       Recombinant Human Regucalcin

RGS1   pro-1118     Recombinant Human Regulator of G-Protein Signaling 1

RGS10 pro-890       Recombinant Human Regulator of G-Protein Signaling 10

RGS14 pro-1151     Recombinant Human Regulator of G-Protein Signaling 14

RGS16 pro-798       Recombinant Human Regulator of G-Protein Signaling 16

RGS17 pro-924       Recombinant Human Regulator of G-Protein Signaling 17

RGS19 pro-037       Recombinant Human Regulator of G-Protein Signaling 19

RGS2   pro-182       Recombinant Human Regulator of G-Protein Signaling 2

RGS21 pro-898       Recombinant Human Regulator of G-Protein Signaling 21

RGS4   pro-900       Recombinant Human Regulator of G-Protein Signaling 4

RGS5   pro-905       Recombinant Human Regulator of G-Protein Signaling 5

RHEB   pro-308       Recombinant Human Ras Homolog Enriched in Brain

RHOA  pro-057       Recombinant Human Ras Homolog Gene Family  Member A

RHOB  pro-224       Recombinant Human Ras Homolog Gene Family  Member B

RHOC  pro-865       Recombinant Human Ras Homolog Gene Family  Member C

RHOD  pro-190       Recombinant Human Ras Homolog Gene Family  Member D

RHOG  pro-1136     Recombinant Human Ras Homolog Gene Family  Member G

RHOV  pro-1199     Recombinant Human Ras Homolog Gene Family  Member V

rHSA HEK  pro-967       Recombinant Human Serum Albumin, HEK

rHSA Plant pro-595       Recombinant Human Serum Albumin, Plant

RLN2    pro-1327     Recombinant Human Relaxin-2

rmS100b     pro-1236     Recombinant Rhesus Macaque S100 Calcium Binding Protein B

RND1   pro-893       Recombinant Human Rho Family GTPase 1

RND3   pro-487      Recombinant Human Rho Family GTPase 3

RNF181      pro-1218     Recombinant Human Ring Finger Protein 181

RNF4   pro-1255     Recombinant Human Ring Finger Protein 4

ROBLD3     pro-050       Recombinant Human Roadblock Domain Containing 3

RORC  pro-206       Recombinant Human RAR-Related Orphan Receptor C

RP9      pro-1314     Recombinant Human Retinitis Pigmentosa 9

RPA2   pro-011       Recombinant Human Replication Protein A2

RPL26L1    pro-1242     Recombinant Human Ribosomal Protein L26-Like 1

RPL8    pro-1053     Recombinant Human Ribosomal Protein L8

RPLP0 pro-392       Recombinant Human Ribosomal Phosphoprotein P0

RPLP1 pro-127       Recombinant Human Ribosomal Phosphoprotein P1

RPLP2 pro-128       Recombinant Human Ribosomal Phosphoprotein P2

RPS3   pro-954       Recombinant Human Ribosomal Protein S3

RPS3A pro-1125     Recombinant Human Ribosomal Protein S3A

RPS5   pro-1300     Recombinant Human Ribosomal Protein S5

RPS7   pro-993       Recombinant Human Ribosomal Protein S7

RPS10 pro-1409     Recombinant Human Ribosomal Protein S10

RPS14 pro-118       Recombinant Human Ribosomal Protein S14

rPVALB       pro-398       Recombinant Rat Parvalbumin

RQCD1       pro-008       Recombinant Human RCD1 Required for Cell Differentiation1

RRAGC      pro-1050     Recombinant Human Ras-Related GTP Binding C

rRAP    pro-352       Recombinant Rat Receptor Associated Protein

RRAS   pro-808       Recombinant Human Related RAS Viral (r-ras) Oncogene Homolog

RRAS2       pro-728       Recombinant Human Related RAS Viral (r-ras) Oncogene Homolog 2

rSCGN pro-657       Recombinant Rat Secretagogin

RSG1   pro-1334     Recombinant Human REM2 and RAB-Like Small GTPase 1

RTN4IP1     pro-1014     Recombinant Human Reticulon 4 Interacting Protein 1

rTpc1808    pro-587       Recombinant Rat Tropic 1808

rTroponin-C      pro-323       Rabbit Skeletal Muscle Troponin-C

RUNX3       pro-836       Recombinant Human Runt-Related Transcription Factor 3

RUVBL1     pro-861       Recombinant Human RuvB-Like 1

rVCAM1      pro-361       Recombinant Rabbit Vascular cell adhesion molecule 1

RWDD1      pro-1309     Recombinant Human RWD Domain Containing 1

RXRA   pro-437       Recombinant Human Retinoid X Receptor Alpha

RYBP   pro-1139     Recombinant Human RING1 & YY1 Binding Protein

S100A1       pro-364       Recombinant Human S100 Calcium Binding Protein A1

mS100A1   pro-237       Recombinant Mouse S100 Calcium Binding Protein A1

S100A10    pro-384       Recombinant Human S100 Calcium Binding Protein A10

S100A11    pro-385       Recombinant Human S100 Calcium Binding Protein A11

S100A12    pro-152       Recombinant Human S100 Calcium Binding Protein A12

S100A13    pro-153       Recombinant Human S100 Calcium Binding Protein A13

S100A14    pro-154       Recombinant Human S100 Calcium Binding Protein A14

S100A16    pro-155       Recombinant Human S100 Calcium Binding Protein A16

S100A2       pro-146       Recombinant Human S100 Calcium Binding Protein A2

S100A3       pro-755       Recombinant Human S100 Calcium Binding Protein A3

mS100A3   pro-1166     Recombinant Mouse S100 Calcium Binding Protein A3

S100A4       pro-307       Recombinant Human S100 Calcium Binding Protein A4

S100A4 His       pro-698       Recombinant Human S100 Calcium Binding Protein A4 His Tag

mS100A4   pro-229       Recombinant Mouse S100 Calcium Binding Protein A4

S100A5       pro-147       Recombinant Human S100 Calcium Binding Protein A5

mS100A5   pro-1084     Recombinant Mouse S100 Calcium Binding Protein A5

S100A6       pro-148       Recombinant Human S100 Calcium Binding Protein A6

mS100A6   pro-409       Mouse S100 Calcium Binding Protein A6

mS100A6   pro-240       Recombinant Mouse S100 Calcium Binding Protein A6

S100A7       pro-149       Recombinant Human S100 Calcium Binding Protein A7

S100A7A    pro-756       Recombinant Human S100 Calcium Binding Protein A7A

S100A8       pro-800       Recombinant Human S100 Calcium Binding Protein A8

S100A8, His      pro-150       Recombinant Human S100 Calcium Binding Protein A8, His Tag

mS100A8   pro-233       Recombinant Mouse S100 Calcium Binding Protein A8

S100A9       pro-814       Recombinant Human S100 Calcium Binding Protein A9

S100A9, His      pro-151       Recombinant Human S100 Calcium Binding Protein A9, His Tag

mS100A9   pro-878       Recombinant Mouse S100 Calcium Binding Protein A9

S100b  pro-306       Recombinant Human S100 Calcium Binding Protein B

mS100b      pro-853       Recombinant Mouse S100 Calcium Binding Protein B

S100b GST       pro-737       Recombinant Human S100 Calcium Binding Protein B,  GST Tag

S100G  pro-399       Recombinant Rat S100 Calcium Binding Protein G

S100G  pro-156       Recombinant Human S100 Calcium Binding Protein G

S100P  pro-425       Recombinant Human S100 Calcium Binding Protein P

S100P His  pro-830       Recombinant Human S100 Calcium Binding Protein P, His Tag

S100Z  pro-840       Recombinant HumanS100 Calcium Binding Protein Z

mS100A15 pro-1145     Recombinant Mouse S100 Calcium Binding Protein A15

SAMD13     pro-355       Recombinant Human Sterile Alpha Motif Domain Containing 13

SAP18 pro-707       Recombinant Human Sin3A-Associated Protein, 18kDa

SAR1A pro-709       Recombinant Human GTP-Binding Protein SAR1A

SAR1B pro-310       Recombinant Human GTP-Binding Protein SAR1B

SBDS   pro-272       Recombinant Human Shwachman-Bodian-Diamond Syndrome

SCAND1    pro-269       Recombinant Human SCAN domain containing 1

SCG5   pro-467       Recombinant Human Secretogranin V

SCGB2A2  pro-515       Recombinant Human Mammaglobin-A

SCGN  pro-599       Recombinant Human Secretagogin

SCO2   pro-054       Recombinant Human SCO Cytochrome Oxidase Deficient Homolog 2

SDC1   pro-1065     Recombinant Human Syndecan-1

SDC1, GST       pro-516       Recombinant Human Syndecan-1, GST tag

SDC4   pro-778       Recombinant Human Syndecan-4

SDC4, His  pro-583       Recombinant Human Syndecan-4, His Tag

SDCBP       pro-036       Recombinant Human Syndecan Binding Protein

SDCBP2     pro-1297     Recombinant Human Syndecan Binding Protein 2

SDHAF2     pro-593       Recombinant Human Succinate Dehydrogenase Complex Assembly Factor 2

SDR16C5   pro-1385     Recombinant Human Short Chain Dehydrogenase/Reductase Family 16C, Member 5

SEC13 pro-194       Recombinant Human SEC13

SEC22B     pro-1212     Recombinant Human SEC22 Homolog B

SecB    pro-697       Recombinant Protein Export Protein SecB

SEPT2 pro-255       Recombinant Human Septin-2

SEPT5 pro-879       Recombinant Human Septin-5

SEPT6 pro-949       Recombinant Human Septin-6

SEPX1 pro-260       Recombinant Human Selenoprotein X 1

SERPINA1 pro-456       Human Alpha-1 Antitrypsin

SERPINA1 pro-529       Recombinant Human Alpha-1 Antitrypsin

SERPINA1, Active  pro-907       Recombinant Human Alpha-1 Antitrypsin, Active

SERPINA3 pro-750       Recombinant Human Alpha-1 AntiChymotrypsin

SERPINA3 pro-378       Human Alpha-1 AntiChymotrypsin

SERPINA5 pro-749       Recombinant Human Serpin Peptidase Inhibitor, Clade A Member 5

SERPINB5       pro-202       Recombinant Human Serpin Peptidase Inhibitor, Clade B Member 5

SERPINB5 His pro-704       Recombinant Human Serpin Peptidase Inhibitor, Clade B Member 5, His Tag

SERPING1 pro-1401     Recombinant Human Serpin Peptidase Inhibitor, Clade G Member 1

SERPINI1   pro-213       Recombinant Human Serpin Peptidase Inhibitor, Clade I Member 1

SERTAD1  pro-1157     Recombinant Human SERTA Domain Containing 1

SF3B14      pro-105       Recombinant Human Splicing Factor 3B, 14 kDa Subunit

SGCD  pro-1373     Recombinant Human Sarcoglycan Delta 

SGTA   pro-807       Recombinant Human Small Glutamine-Rich Tetratricopeptide Repeat-Containing Protein Alpha

SH2D1A     pro-006       Recombinant Human SH2 domain containing 1A

SH3BGRL  pro-1159     Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like

SH3BGRL2       pro-1215     Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like 2

SH3BGRL3       pro-1216     Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like 3

SH3GL2      pro-1083     Recombinant Human SH3-domain GRB2-like 2

SH3GLB1   pro-1278     Recombinant Human SH3-domain GRB2-like endophilin B1

SH3GLB2   pro-1287     Recombinant Human SH3-domain GRB2-like endophilin B2

SHC1   pro-883       Recombinant Human SHC-Transforming Protein 1

SIL1      pro-1187     Recombinant Human SIL1

SIRT2   pro-033       Recombinant Human SIrtuin-2

SIRT3   pro-462       Recombinant Human SIrtuin-3

SIRT6   pro-282       Recombinant Human SIrtuin-6

SIT1      pro-928       Recombinant Human Signaling Threshold Regulating Transmembrane Adaptor 1

SIX1     pro-1226     Recombinant Human SIX Homeobox 1

SIX6     pro-1253     Recombinant Human SIX Homeobox 6

SLAMF1     pro-1342     Recombinant Human SLAMF1

SLAMF6     pro-1286     Recombinant Human SLAMF6

SLC4A4      pro-688       Recombinant Human Solute Carrier Family 4, Sodium Bicarbonate Cotransporter, Member 4

SLPI     pro-849       Recombinant Human Secretory Leukocyte Peptidase Inhibitor

SMAC/DIABLO pro-614       Recombinant Human SMAC/DIABLO

SMAD2       pro-691       Recombinant Human SMAD Family Member 2

SMAD3       pro-751       Recombinant Human Mothers Against Decapentaplegic Homolog 3

SMAD4       pro-459       Recombinant Human Mothers Against Decapentaplegic Homolog 4

SMNDC1    pro-035       Recombinant Human Survival Motor Neuron Domain Containing 1

SNAP23     pro-659       Recombinant Human Synaptosomal-associated protein 23kDa

SNAP25     pro-573       Recombinant Human Synaptosomal-associated protein 25kDa

SNAP-25    pro-396       Recombinant Synaptosomal-associated protein 25kDa, C.elegans

SNAP25B   pro-635       Recombinant Human Synaptosomal-associated protein 25B

SNAPIN      pro-663       Recombinant Human SNAP Associated Protein

SNCA   pro-393       Recombinant Human Alpha-Synuclein

SNCA 1-60 pro-165       Recombinant Human Alpha-Synuclein 1-60

SNCA 61-140   pro-163       Recombinant Human Alpha-Synuclein 61-140

SNCA 96-140   pro-164       Recombinant Human Alpha-Synuclein 96-140

SNCA A30P      pro-158       Recombinant Human Alpha-Synuclein A30P

SNCA A30P/A53T  pro-160       Recombinant Human Alpha-Synuclein A30P/A53T

SNCA A53T      pro-159       Recombinant Human Alpha-Synuclein A53T

SNCA Delta-NAC   pro-161       Recombinant Human Alpha-Synuclein Delta-NAC

SNCA NACP112    pro-162       Recombinant Human Alpha-Synuclein NACP112

CA      pro-858       Recombinant Mouse Alpha-Synuclein

SNCB   pro-394       Recombinant Human Beta-Synuclein

SNCG  pro-395       Recombinant Human Gamma-Synuclein

SNF8    pro-1135     Recombinant Human SNF8, ESCRT-II Complex Subunit

SNIP1  pro-201       Recombinant Human Smad Nuclear Interacting Protein 1

SNPH   pro-545       Recombinant Human Syntaphilin

SNRNP25  pro-226       Recombinant Human Small Nuclear Ribonucleoprotein 25kDa

SNRNP70  pro-445       Recombinant Human Small Nuclear Ribonucleoprotein 70kDa

SNRPA1     pro-1015     Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide A

SNRPB2     pro-217       Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide B

SNRPC       pro-1004     Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide C

SNRPD       pro-997       Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D1, D2, D3

SNRPD1    pro-994       Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D1

SNRPD2    pro-123       Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D2

SNRPD2, Sf9   pro-995       Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D2, Sf9

SNRPD3    pro-945       Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D3

SNRPD3, Sf9   pro-996       Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D3, Sf9

SNRPE       pro-104       Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide E

SNRPF       pro-041       Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide F

SNRPG       pro-196       Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide G

SNTA1 pro-1016     Recombinant Human Syntrophin, Alpha 1

SNTN   pro-216       Recombinant Human Sentan Cilia Apical Structure Protein

SNUPN       pro-866       Recombinant Human Snurportin 1

SNX1   pro-665       Recombinant Human Sorting Nexin 1

SNX3   pro-246       Recombinant Human Sorting Nexin 3

SOD     pro-286       Recombinant Human Superoxide Dismutase

SOD His     pro-1239     Recombinant Human Superoxide Dismutase His Tag

SOD1   pro-648       Recombinant Human Superoxide Dismutase-1

SOD2   pro-819       Recombinant Human Superoxide Dismutase-2

SODA   pro-208       Recombinant E.Coli Superoxide Dismutase

SOSTDC1  pro-426       Recombinant Human Sclerostin Domain Containing 1

SOX2   pro-820       Recombinant Human SRY (sex determining region Y)-box 2

SOX2 PolyR     pro-089       Recombinant Human SRY (sex determining region Y)-box 2 Polyarginine-Tag

Sox2-TAT   pro-1343     Recombinant Human SRY (sex determining region Y)-box 2 TAT

SOX9 pro-739       Recombinant Human SOX9

SP100  pro-108       Recombinant Human SP100

SPA      pro-356       Recombinant Staphylococcal Protein-A

SPA 41kDa       pro-774       Recombinant Staphylococcal Protein-A 41kDa

SPA 434a.a.      pro-686       Recombinant Staphylococcal Protein A 434 a.a

SPARC       pro-582       Recombinant Human Secreted Protein Acidic & Rich in Cysteine

SPG21 pro-677       Recombinant Human Spastic Paraplegia 21

SPIN1  pro-1184     Recombinant Human Spindlin-1

SPINT  pro-1296     Recombinant Human Serine Peptidase Inhibitor, Kunitz Type 2

SPOP   pro-195       Recombinant Human Speckle-Type POZ Protein

SPSB1 pro-223       Recombinant Human SPRY Domain-Containing SOCS Cox Protein 1

SPSB2 pro-1264     Recombinant Human SPRY Domain-Containing SOCS Cox Protein 2

SQSTM1     pro-806       Recombinant Human Sequestosome 1

SRA1   pro-1274     Recombinant Human Steroid Receptor RNA Activator 1

sRAGE pro-600       Recombinant Human Advanced Glycosylation End Product-Specific Receptor

sRAGE HEK     pro-601       Recombinant Human Advanced Glycosylation End Product-Specific Receptor, HEK

SRSF1 pro-1352     Recombinant Human Serine/arginine-Rich Splicing Factor 1

SRGN  pro-965       Recombinant Human Serglycin

SRI       pro-166       Recombinant Human Sorcin

SRP14 pro-013       Recombinant Human Signal Recognition Particle 14kDa

SRP54 pro-113       Recombinant Human Signal Recognition Particle 54kDa

SSBP1 pro-1408     Recombinant Human Single-Stranded DNA Binding Protein 1

SSR2   pro-1380     Recombinant Human Signal Sequence Receptor, Beta

SSR4   pro-1294     Recombinant Human Signal Sequence Receptor, Delta

SSX1    pro-1379     Recombinant Human Synovial Sarcoma, X Breakpoint 1

STAMBP     pro-017       Recombinant Human STAM Binding Protein

STAMBPL1       pro-1354     Recombinant Human STAM Binding Protein Like 1

STAP1 pro-1110     Recombinant Human Signal Transducing Adaptor Family Member 1

STAR   pro-979       Recombinant Human Steroidogenic Acute Regulatory Protein

STIM1   pro-620       Recombinant Human Stromal Interaction Molecule 1

STIP1   pro-753       Recombinant Human Stress-Induced-Phosphoprotein 1

STMN1 pro-676       Recombinant Human Stathmin-1

STMN2 pro-752       Recombinant Human Stathmin Like-2

STMN3 pro-838       Recombinant Human Stathmin Like-3

Streptavidin       pro-283       Streptavidin

Streptavidin       pro-791       Recombinant Streptavidin

Streptavidin, His      pro-621       Recombinant Streptavidin, His Tag

Streptavidin-NC      pro-338       Recombinant Streptavidin-NC

STX11  pro-1111     Recombinant Human Syntaxin-11

STX12  pro-1099     Recombinant Human Syntaxin-12

STX1A pro-574       Recombinant Human Syntaxin-1A

STX2    pro-1146     Recombinant Human Syntaxin-2

STX3    pro-1082     Recombinant Human Syntaxin-3

STX4    pro-1176     Recombinant Human Syntaxin-4

SUB1   pro-835       Recombinant Human SUB1 Homolog

SUFU   pro-938       Recombinant Human Suppressor of Fused Homolog

SUGT1 pro-096       Recombinant Human SGT1

SUMF1       pro-986       Recombinant Human Sulfatase Modifying Factor 1

SUMO1       pro-326       Recombinant Human Small Ubiquitin-Related Modifier 1

SUMO1 His       pro-980       Recombinant Human Small Ubiquitin-Related Modifier 1, His Tag

SUMO2       pro-586       Recombinant Human Small Ubiquitin-Related Modifier 2

SUMO2 GST     pro-541       Recombinant Human Small Ubiquitin-Related Modifier 2, GST

SUMO3       pro-267       Recombinant Human Small Ubiquitin-Related Modifier 3

SURF1 pro-764       Recombinant Human Surfeit-1

SYCE3 pro-1179     Recombinant Human Synaptonemal Complex Central Element Protein 3

SYF2    pro-969       Recombinant Human SYF2 RNA splicing factor

SYT1    pro-239       Recombinant Human Synaptotagmin I

SYT4    pro-1375     Recombinant Human Synaptotagmin IV

TAC1    pro-1338     Recombinant Human Tachykinin-1

TAC3    pro-716       Recombinant Human Tachykinin-3

TACSTD2   pro-157       Recombinant Human Tumor-Associated Calcium Signal Transducer 2

TAGLN pro-851       Recombinant Human Transgelin

TAGLN2      pro-124       Recombinant Human Transgelin-2

TAGLN3      pro-946       Recombinant Human Transgelin-3

TANK   pro-1348     Recombinant Human TRAF Family Member-Associated NFKB Activator

TARDBP     pro-1410     Recombinant Human TAR DNA Binding Protein

TAX1BP3   pro-981       Recombinant Human Tax1 Binding Protein 3

TBCA   pro-705       Recombinant Human Tubulin Folding Cofactor A

TBCB   pro-1127     Recombinant Human Tubulin Folding Cofactor B

TBCC   pro-1180     Recombinant Human Tubulin Folding Cofactor C

TBPL1  pro-736       Recombinant Human TBP-Like 1

TBCEL pro-030       Recombinant Human Tubulin Folding Cofactor E-Like

TCEA1 pro-1098     Recombinant Human Transcription Elongation Factor A (SII)- 1

TCEAL1      pro-507       Recombinant Human Transcription Elongation Factor A (SII)-Like 1

TCEAL3      pro-1128     Recombinant Human Transcription Elongation Factor A (SII)-Like 3

TCEAL7      pro-1147     Recombinant Human Transcription Elongation Factor A (SII)-Like 7

TCEAL8      pro-1188     Recombinant Human Transcription Elongation Factor A (SII)-Like 8

TCEB1 pro-1017     Recombinant Human Transcription Elongation Factor B Polypeptide 1

TCEB2 pro-664       Recombinant Human Transcription Elongation Factor B Polypeptide 2

TCL1A  pro-726       Recombinant Human T-cell Leukemia/Lymphoma 1A

TCP1    pro-276       Recombinant Human T-Complex 1

TES      pro-549       Recombinant Human Testis Derived Transcript

TEV      pro-585       Recombinant Tobacco Etch Virus Protease

TFAM   pro-095       Recombinant Human Transcription Factor-A

TFB1M pro-903       Recombinant Human Transcription Factor B1, Mitochondrial

TFB2M pro-1259     Recombinant Human Transcription Factor B2, Mitochondrial

TFPI2   pro-860       Recombinant Human Tissue Factor Pathway Inhibitor 2

TGFBI   pro-568       Recombinant Human Transforming Growth Factor Beta Induced

TGFBI 182  pro-672       Recombinant Human Transforming Growth Factor Beta Induced 182 a.a.

THAP1 pro-1089     Recombinant Human THAP Domain Containing, Apoptosis Associated Protein 1

THBS1 pro-288       Recombinant Human Thrombospondin

Thrombin    pro-339       Human Thrombin

THYN1 pro-270       Recombinant Human Thymocyte Nuclear Protein 1

Thyroglobulin   pro-443       Human Thyroglobulin

TIAF1   pro-1211     Recombinant Human TGFB1-Induced Anti-Apoptotic Factor 1

TICAM2       pro-1036     Recombinant Human Toll-Like Receptor Adaptor Molecule 2

TIFA      pro-1041     Recombiant Human TRAF-Interacting Protein with Forkhead-Associated Domain

TIRAP  pro-1181     Recombinant Human Toll-Interleukin 1 Receptor (TIR) Domain Containing Adaptor Protein

TMOD3       pro-1165     Recombinant Human Tropomodulin 3

TNIP1   pro-005       Recombinant Human TNFAIP3 Interacting Protein 1

TNNI1   pro-1269     Recombinant Human Troponin I Type 1

TNNI2   pro-1283     Recombinant Human Troponin I Type 2

TNNT2 pro-703       Recombinant Human Troponin T Type 2, Cardiac Isoform 3

TOLLIP pro-228       Recombinant Human Toll Interacting Protein

TPD52L1    pro-442       Recombinant Human Tumor Protein D52 L1

TPM1    pro-469       Recombinant Human Tropomyosin-1

TPM2    pro-069       Recombinant Human Tropomyosin-2

TPM3    pro-1020     Recombinant Human Tropomyosin-3

TPM4    pro-187       Recombinant Human Tropomyosin-4

TPRKB pro-1185     Recombinant Human TP53RK Binding Protein

TPT1     pro-776       Recombinant Human Tumor Protein Translationally-Controlled 1

TRAF1 pro-834       Recombinant Human TNF receptor-Associated Factor 1

TRAF2 pro-685       Recombinant Human TNF receptor-Associated Factor 2

Transferrin pro-747      Recombinant Human Transferrin

TRAPPC2  pro-1272     Recombinant Human Trafficking Protein Particle Complex 2

TRAPPC3  pro-1056     Recombinant Human Trafficking Protein Particle Complex 3

TRAPPC4  pro-1273     Recombinant Human Trafficking Protein Particle Complex 4

TREM1 pro-457       Recombinant Human Triggering Receptor Expressed on Myeloid Cells 1

TRIM21       pro-328       Recombinant Human Tripartite Motif Containing 21 (RO52)

Troponin 1  pro-341       Recombinant Human fast skeletal Troponin 1

Troponin I-C      pro-344       Recombinant Human Cardiac Troponin I-C Complex

Troponin I-C     pro-345       Recombinant Single Chain Cardiac Troponin I-C

Troponin I-C     pro-346       Recombinant Single Chain Cardiac Troponin I-C 2nd generation

Troponin-C pro-322       Recombinant Human Cardiac Troponin-C

Troponin-C His pro-959       Recombinant Human Cardiac Troponin-C His

Troponin-I   pro-324       Recombinant Human Cardiac Troponin-I

Troponin-T pro-342       Human Cardiac Troponin-T

TROVE2     pro-329       Recombinant Human TROVE Domain Family Member 2

TROVE2 His     pro-110       Recombinant Human TROVE Domain Family Member 2 His Tag

Trypsin pro-770       Recombinant Human Trypsin

Trypsin Yeast    pro-786       Recombinant Human Trypsin, Yeast

TSC22D3   pro-1254     Recombinant Human TSC22 Domain Family, Member 3

TSEN15      pro-144       Recombinant Human tRNA Splicing Endonuclease 15

TSG101      pro-805       Recombinant Human Tumor Susceptibility Gene 101

TSN      pro-271       Recombinant Human Translin

TSNAX pro-1292     Recombinant Human Translin-Associated Factor X

TSSC4 pro-1021     Recombinant Human Tumor Suppressing Subtransferable Candidate 4

TTC1    pro-1160     Recombinant Human Tetratricopeptide Repeat Domain 1

TTC32  pro-1246     Recombinant Human Tetratricopeptide Repeat Domain 32

TTC33  pro-1217     Recombinant Human Tetratricopeptide Repeat Domain 33

TUBB3 pro-1388     Recombinant Human Tubulin, Beta 3 Class III

TUBG1 pro-982       Recombinant Human Tubulin Gamma 1

TULP1  pro-1191     Recombinant Human Tubby Like Protein 1

TWF1   pro-1003     Recombinant Human Twinfilin-1

TXN1    pro-334       Recombinant E.Coli Thioredoxin

TXN1    pro-569       Recombinant Human Thioredoxin

TXN1, His   pro-784       Recombinant E.Coli Thioredoxin, His

TXN1, His   pro-804       Recombinant Human Thioredoxin His Tag

TXN2    pro-625       Recombinant Human Thioredoxin-2

TXNDC12   pro-1133     Recombinant Human Thioredoxin Domain Containing 12

TXNDC17   pro-1055     Recombinant Human Thioredoxin Domain Containing 17

TXNL1  pro-084       Recombinant Human Thioredoxin-Like 1

TXNL4A      pro-1100     Recombinant Human Thioredoxin-Like 4A

TXNL4B      pro-238       Recombinant Human Thioredoxin-Like 4B

TYW5   pro-1315     Recombinant Human tRNA-yW Synthesizing Protein 5

U. Urealyticum        pro-670       Recombinant Ureaplasma Urealyticum Parvum

UBD     pro-927       Recombinant Human Ubiquitin-D

Ubiquitin     pro-314       Recombinant Human Ubiquitin

Ubiquitin Biotin       pro-629       Recombinant Human Ubiquitin Biotin

Ubiquitin G76A       pro-280       Recombinant Human Ubiquitin Gly76 to Ala76 mutation

Ubiquitin GST   pro-735       Recombinant Human Ubiquitin, GST Tag

Ubiquitin K48R       pro-372       Recombinant Human Ubiquitin Lys 48 to Arg 48 mutation

UBL3    pro-230       Recombinant Human Ubiquitin-Like 3

UBL4A pro-1043     Recombinant Human Ubiquitin-Like 4A

UBL5    pro-231       Recombinant Human Ubiquitin-Like 5

UBTD2 pro-1203     Recombinant Human Ubiquitin Domain Containing 2

UFM1   pro-125       Recombinant Human Ubiquitin-Fold Modifier 1

UFSP1 pro-1320     Recombinant Human UFM1-Specific Peptidase 1

ULBP2 pro-1134     Recombinant Human UL16 Binding Protein 2

Ulinastatin  pro-608       Recombinant Human Urinary Trypsin Inhibitor (UTI)

Ulinastatin  pro-321       Human Urinary Trypsin Inhibitor (UTI)

UNC119B   pro-1034     Recombinant Human UNC-119 Homolog B

UPK2   pro-479       Recombinant Human Uroplakin 2

UPK3A pro-988       Recombinant Human Uroplakin 3A

UQCRC2    pro-1224     Recombinant Human Ubiquinol-Cytochrome C Reductase Core Protein II

URM1   pro-188       Recombinant Human Ubiquitin Related Modifier 1

USH1C       pro-706       Recombinant Human Usher Syndrome 1C

USP14 pro-016       Recombinant Human Ubiquitin Specific Peptidase 14

UTP23  pro-1235     Recombinant Human UTP23, Small Subunit Processome Component

UXT      pro-1312     Recombinant Human Ubiquitously-Expressed, Prefoldin-Like Chaperone

VAMP1       pro-577       Recombinant Human Synaptobrevin-1

VAMP2       pro-578       Recombinant Human Synaptobrevin-2

VAMP3       pro-652       Recombinant Human Synaptobrevin-3

VAMP4       pro-714       Recombinant Human Vesicle-Associated Membrane Protein 4

VAMP5       pro-681       Recombinant Human Synaptobrevin-5

VAMP7       pro-1194     Recombinant Human Vesicle-Associated Membrane Protein 7

VAMP8       pro-660       Recombinant Human Synaptobrevin-8

VAPA   pro-779       Recombinant Human VAMP Associated Protein A, 33kDa

VAPB   pro-014       Recombinant Human VAMP Associated Protein B and C

VASP   pro-191       Recombinant Human Vasodilator-Stimulated Phosphoprotein

VAT1    pro-1011     Recombinant Human Vesicle Amine Transport Protein 1 Homolog

VBP1    pro-1325     Recombinant Human Von Hippel-Lindau Binding Protein 1

VCAM1       pro-386       Recombinant Human Vascular cell adhesion molecule 1

VDR     pro-205      Recombinant Human Vitamin D Receptor

VHL      pro-440      Recombinant Human Von Hippel-Lindau Protein

Vimentin     pro-309      Recombinant Human Vimentin

Vimentin GST   pro-734       Recombinant Human Vimentin, GST Tag

VOPP1 pro-200      Recombinant Human Vesicular Overexpressed in Cancer, Prosurvival Protein 1

VPS24 pro-872       Recombinant Human Vacuolar Protein Sorting 24

VPS25 pro-1054     Recombinant Human Vacuolar Protein Sorting 25

VPS26A      pro-1161     Recombinant Human Vacuolar Protein Sorting 26A

VPS28 pro-730       Recombinant Human Vacuolar Protein Sorting 28

VPS29 pro-1075     Recombinant Human Vacuolar Protein Sorting 29

mVPS29     pro-1066     Recombinant Mouse Vacuolar Protein Sorting 29

VRK3   pro-1130     Recombinant Human Vaccinia Related Kinase 3

VSNL1       pro-723       Recombinant Human Visinin-Like Protein-1

VSNL1 His pro-602       Recombinant Human Visinin-Like Protein-1 His Tag

VSTM2L      pro-1018     Recombinant Human V-Set and Transmembrane Domain Containing 2 Like

VTA1    pro-1044     Recombinant Human Vps20-Associated 1 Homolog

VTI1B   pro-1115     Recombinant Human Vesicle Transport Through Interaction with t-SNAREs Homolog 1B

WBP2   pro-1208     Recombinant Human WW Domain Binding Protein 2

WDR5  pro-863       Recombinant Human WD Repeat Domain 5

WHSC2      pro-062       Recombinant Human Wolf-Hirschhorn Syndrome Candidate 2

WIBG    pro-864      Recombinant Human within BCGN Homolog

WIF1     pro-684       Recombinant Human WNT Inhibitory Factor 1

WLS     pro-1402     Recombinant Human Wntless 

XAGE1A     pro-1256     Recombinant Human X Antigen Family, Member 1A

XG pro-1395     Recombinant Human XG Blood Group

XPA      pro-026      Recombinant Human Xeroderma Pigmentosum, Complementation Group A

YEATS4      pro-1019     Recombinant Human YEATS Domain Containing 4

yTXN1  pro-333       Recombinant Yeast Thioredoxin

重慶市華雅干細(xì)胞技術(shù)有限公司    

 


產(chǎn)品咨詢

留言框

  • 產(chǎn)品:

  • 您的單位:

  • 您的姓名:

  • 聯(lián)系電話:

  • 常用郵箱:

  • 省份:

  • 詳細(xì)地址:

  • 補(bǔ)充說明:

  • 驗(yàn)證碼:

    請輸入計(jì)算結(jié)果(填寫阿拉伯?dāng)?shù)字),如:三加四=7
推薦產(chǎn)品

2025 版權(quán)所有 © 重慶市華雅干細(xì)胞技術(shù)有限公司  備案號(hào):渝ICP備14000349號(hào)-4 sitemap.xml 管理登陸 技術(shù)支持:化工儀器網(wǎng)

地址:重慶市江北區(qū)金渝大道153號(hào)8棟20-14 傳真:023-63419626 郵件:sales@ys-bio.com

重慶市華雅干細(xì)胞技術(shù)有限公司主要經(jīng)營干細(xì)胞研究 干細(xì)胞治療產(chǎn)品 生物試劑 實(shí)驗(yàn)耗材 藥物研發(fā)等產(chǎn)品。

關(guān)注我們

服務(wù)熱線

400-021-2200

掃一掃,關(guān)注我們